KEGG   Bacillus subtilis subsp. subtilis 168: BSU23920
Entry
BSU23920          CDS       T00010                                 

Gene name
yqjD
Definition
(RefSeq) propionyl-CoA carboxylase beta chain
  KO
K01966  propionyl-CoA carboxylase beta chain [EC:6.4.1.3 2.1.3.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00280  Valine, leucine and isoleucine degradation
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU23920 (yqjD)
   00640 Propanoate metabolism
    BSU23920 (yqjD)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU23920 (yqjD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     BSU23920 (yqjD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     BSU23920 (yqjD)
SSDB
Motif
Pfam: Carboxyl_trans MdcE BIV_Env
Other DBs
NCBI-GeneID: 938685
NCBI-ProteinID: NP_390272
Pasteur: BG11733
BSORF: BG11733
UniProt: P54541 A0A6M3ZJ23
Position
complement(2486813..2488336)
AA seq 507 aa
MNEHMDHFYTKRKQAEEGGGREKLAQQRQKGKLTARERIIFLLDQDSFIELHPFMESQVL
TREQRMLGDGVVTGYGTIDGRSVYVFAQDFTVYGGALGETHARKICALMDLAAKNKAPII
GLNDSGGARIQEGVLSLDGYGHIFYRNVLYSGVIPQISVILGPCAGGAVYSPALTDFIFM
AEQTGRMFITGPKVIEKVTGEQVDAESLGGAGIHNAVSGNAHFSGHTEKEVLTGVRKLLS
YLPLNGRTTEPKPEKEASRPLLNRLVPADTTKPYDVRKVIRELADPQSFFEIQPFFAKNI
VIGFARLGEKAIGIVASQPKHLAGSLTIDAADKAARFIRFCDAFDIPLLTVEDVPGFLPG
IQQEHNGIIRHGAKLLFAYAEATVPKVTLIIRKAYGGAYVAMNSKAIGADLVFAWPNAEI
AVMGPEGAASILYEKEIKASADPQKTKREKTAEYKKQNAGPYKAAACGMVDDIILPEESR
GRLIQAFHMLTHKTEERPKKKHGNIPL
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgaatgagcacatggatcatttttacacgaaacgcaagcaggcagaagaaggcggagga
cgggaaaagctggctcagcagcggcaaaagggcaagctcactgctcgggaaaggatcata
tttcttctagatcaggacagctttatcgaattacaccccttcatggaaagtcaagtgtta
acaagagaacagcgcatgttaggggatggggtcgtgacagggtacggcacaattgacggt
cgctcagtttatgtatttgcgcaagacttcacagtgtacggaggggcgcttggcgaaacc
catgccaggaaaatctgcgctttgatggatctggcagcaaaaaataaggcgccgattatc
gggctgaatgactcaggtggtgcgagaattcaagagggtgtgttatcattagatggatac
ggtcacatattttaccgaaacgtcttatattccggagtcattccgcaaatatcggttatt
ttagggccgtgcgctggaggcgctgtatattctccggcactcacagattttatatttatg
gctgaacagactggccggatgtttattaccggcccgaaggtgattgaaaaagtgacaggg
gaacaggttgatgcggagagcttaggcggagcggggatacataatgccgtcagcggaaac
gcccacttttccgggcatacggagaaggaggttctgacaggggtgagaaaactactgtct
tatttgccgctgaatggccggacaacagagccgaagccagagaaagaggcgtccagaccg
ttattaaaccgtcttgtccctgctgatacgacaaagccttatgatgttcggaaggtgatt
agggagctggctgacccgcagtctttttttgagattcagccattttttgcgaagaacatt
gtcattgggtttgcaaggctgggtgaaaaagcaatcggcatcgtggcgagccagccgaag
catctggcgggaagcctgacgattgacgctgctgataaagcagcaaggttcatccgtttt
tgtgacgcatttgatatcccgctgttgactgtcgaagatgtcccggggtttctgccgggt
attcagcaagagcacaacggaatcatcaggcatggagcaaaattattgtttgcttatgct
gaagcgactgtcccaaaagtcacactcatcattagaaaagcgtacggcggcgcctatgtg
gccatgaacagcaaagcgatcggagcggaccttgtgtttgcatggccgaatgctgaaatc
gcagtgatgggtccagaaggtgcggcatcgattttgtatgaaaaggaaatcaaagcttca
gctgacccgcaaaagacgaaacgcgaaaaaactgctgaatacaaaaagcaaaacgccggc
ccatacaaagcggccgcttgtggaatggtcgatgacatcattttgccggaagaatcaagg
ggaagactgattcaagcttttcatatgcttacacataagacagaagagagaccgaaaaaa
aagcacggtaacataccgctttaa

DBGET integrated database retrieval system