KEGG   Bacillus subtilis subsp. subtilis 168: BSU23930
Entry
BSU23930          CDS       T00010                                 

Symbol
yqjC
Name
(RefSeq) hypothetical protein
  KO
K05606  methylmalonyl-CoA/ethylmalonyl-CoA epimerase [EC:5.1.99.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00280  Valine, leucine and isoleucine degradation
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU23930 (yqjC)
   00640 Propanoate metabolism
    BSU23930 (yqjC)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU23930 (yqjC)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.1  methylmalonyl-CoA epimerase
     BSU23930 (yqjC)
SSDB
Motif
Pfam: Glyoxalase_4 Glyoxalase Glyoxalase_3 Lyase_8_C
Other DBs
NCBI-GeneID: 938689
NCBI-ProteinID: NP_390273
Pasteur: BG11732
BSORF: BG11732
UniProt: P54540 A0A6M4JIY1
Position
complement(2488329..2488751)
AA seq 140 aa
MNRLDHIGIAVFSIKDARSFYENVLGLAFLHQETVEEQKVNVAFFQAGSVKLELIEPLTA
DSPVHLFLEKKGQGLHHIAFLCNCLSEQLQALSDQHVQLIDRFPRQGANGKKIAFISPRE
TNGVLVELCEPKGDQHNEHE
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaacaggcttgaccatatcgggatagccgttttttcgataaaagatgcaagaagcttt
tatgaaaatgtattggggcttgcatttcttcatcaagaaacggttgaagagcaaaaggtg
aatgttgctttttttcaagctggtagcgtcaaacttgagctgatagagccgttgacagct
gacagccccgtccatttatttttggagaagaaagggcagggactgcatcatattgcgttt
ttgtgcaactgcctatctgaacagcttcaagcattgtctgatcagcatgttcaattgatt
gacaggtttccaagacagggagcgaacgggaaaaagatcgcgtttatttcccctcgggaa
acaaacggtgttcttgtagagctttgtgaaccgaaaggagaccaacacaatgagcatgaa
tga

DBGET integrated database retrieval system