KEGG   Bacillus subtilis subsp. subtilis 168: BSU23940
Entry
BSU23940          CDS       T00010                                 

Symbol
yqjB
Name
(RefSeq) L,D-transpeptidase YqjB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YkuD
Other DBs
NCBI-GeneID: 938684
NCBI-ProteinID: NP_390274
Pasteur: BG11731
BSORF: BG11731
UniProt: P54539 A0A6M3ZDU2
Position
complement(2488953..2489483)
AA seq 176 aa
MRFFLCSIFMMISPIWPLGENPLPGDPYVIVNKRTNELAVILDNKVEGVYSVATGKTDDL
TPEGEFSVTVKAENPYYRKKNIEGGSPDNPLGARWIGFDAKGTDGRIYGIHGTNREESVG
KFVSNGCIRMHNDEVVHLFQTIPVGTRVLITDDNRSFEEIAIEHKALIKKQDIPIE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgcgttttttcttatgttcgattttcatgatgatttcaccgatttggccgctcggcgaa
aatccgctgccgggtgatccgtatgttattgtcaacaagcgaacaaatgaacttgctgtt
atcctcgacaacaaagtagaaggcgtgtatagtgtggcgactggaaaaacagatgatttg
acgcctgaaggagagttttcggtaacggtaaaagcggaaaatccttactacagaaagaaa
aatattgaagggggatctcctgataacccgcttggggcaagatggatcggatttgacgcg
aaaggaacggacgggcggatttatggaattcatgggacaaaccgagaggaatcagtagga
aaatttgtgtctaacggctgtatacgtatgcataacgatgaggttgttcatttgtttcaa
acgataccagtaggaacgagagtgctgatcacggacgacaaccgctcttttgaggagatt
gccatcgagcataaagctctgataaaaaagcaggatattcccattgaataa

DBGET integrated database retrieval system