KEGG   Bacillus subtilis subsp. subtilis 168: BSU23950
Entry
BSU23950          CDS       T00010                                 

Symbol
yqjA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ArAE_1_C ArAE_1 FUSC_2
Other DBs
NCBI-GeneID: 938681
NCBI-ProteinID: NP_390275
Pasteur: BG11730
BSORF: BG11730
UniProt: P54538 A0A6M4JLK6
Position
complement(2489535..2490503)
AA seq 322 aa
MFKIGYRTIKTALGTALAIYISQLLHLQNFASAGIITILCIQITQKRSLQASWARFSACC
LAIAFSYLFFELIGYHPFVIGALLLIFIPITVLLKINEGIVTSSVIILHLYMSGGITPTF
IWNEVQLITVGIGVALLMNLYMPSLDRKLIAYRKKIEDNFAVIFAEIERYLLTGEQDWSG
KEIPETHQLITEAKNLAYRDVQNHILRYENLHYHYFKMREKQFEIIERLLPKVTSISITV
DQGKMIAEFIHDLREAIHPGNTAYKFLKRLADMRKEFEEMPLPATREEFEARAALFHLLG
EMEQYLVIKSYFKGIKAQKSLG
NT seq 969 nt   +upstreamnt  +downstreamnt
atgtttaaaattggttaccgcacaataaagaccgcgcttggaacagctttggctatttat
ataagccagttattgcatttgcaaaacttcgcatcagcaggaatcatcaccattttgtgc
atacaaatcacacaaaaacggtcgcttcaggcctcatgggcccgcttttcggcatgctgt
ctggcaattgctttttcttatctctttttcgagcttattggctaccacccgtttgtgatc
ggagcgcttcttttgatattcattccgataacggttctgttaaaaattaacgagggtatc
gtcaccagttctgttattatccttcatttatacatgtccggcggcattacgcctactttc
atctggaatgaagttcagctgattacggttggcatcggcgtcgctctattgatgaacttg
tatatgcctagtcttgaccggaaactgattgcctaccgcaaaaagatagaggataacttt
gctgtcatttttgcagaaatcgaacggtatttgttaactggtgagcaagattggtcagga
aaagaaattccggaaacgcaccagctcattacggaggctaaaaacctggcatatcgagat
gtgcaaaaccacattttgcgttatgaaaatctgcattatcattattttaaaatgagagaa
aagcaatttgaaattatcgaacgccttctccctaaagtgacatcgatctccatcacggta
gatcagggaaaaatgatcgctgaatttattcatgatttgcgggaggcgatacaccctggg
aatacagcatacaaatttctgaaaagacttgctgacatgagaaaagaatttgaggagatg
ccgcttcctgcgactagagaggaatttgaagcgagggccgctctcttccatcttctcggc
gaaatggaacaatatttagtgattaaaagttattttaaaggaataaaagcgcaaaaatca
ctcggatga

DBGET integrated database retrieval system