KEGG   Bacillus subtilis subsp. subtilis 168: BSU23980
Entry
BSU23980          CDS       T00010                                 

Gene name
artP
Definition
(RefSeq) arginine-binding extracellular protein ArtP
  KO
K23059  arginine/lysine/histidine transporter system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU23980 (artP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU23980 (artP)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/lysine/histidine transporter
    BSU23980 (artP)
SSDB
Motif
Pfam: SBP_bac_3 NMT1 Phosphonate-bd Lig_chan-Glu_bd OpuAC NMT1_3 Phage_TAC_5 SBP_bac_5 DUF4969 Methyltransf_31
Other DBs
NCBI-GeneID: 938682
NCBI-ProteinID: NP_390278
Pasteur: BG11727
BSORF: BG11727
UniProt: P54535 A0A6M3ZDM8
Position
complement(2492029..2492796)
AA seq 255 aa
MKKWLLLLVAACITFALTACGSSNSGSESGKKKLIMGTSADYKPFEYKEGDNIVGFDVEL
AKALAKKAGYEIEVQDMDFNSLITALKSKQVDLVLSGMTPTPERKKQVDFSDVYYTANHM
IVSKKDSGIQSLKDLKGKTVGVQLGSIQEEKGKELSPEYGFKTEDRNRISDLVQEIKSDR
FDAAIIEDIVAEGYFKSNDDLQGFVIPDAKAEEAGSAIAFRKDSELTDKFNKALKEMEDN
GELEKLKKKWFTGEK
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaaaaaatggctcttattacttgtggctgcttgcatcacctttgcattaactgcgtgc
ggctcaagcaattcaggttcagaaagcggaaagaaaaaattaattatgggtacttcggcg
gattacaaaccgtttgaatataaagaaggagataatattgtcggctttgatgtagagctg
gcaaaagctctggcaaagaaggcaggctatgaaattgaagtgcaggatatggacttcaac
agcttaattacagcgcttaaatcaaaacaggtggatctcgttctgtcaggaatgacacca
acgcctgagcgtaaaaaacaagttgatttttccgatgtgtattacacagcgaaccatatg
attgtcagcaaaaaagacagcggcattcaatctttgaaagacctgaaaggaaaaacagtt
ggcgttcagcttggctctattcaggaagagaaggggaaagagctttctccggaatatggt
tttaaaacagaagaccgcaacagaatttctgatttggtgcaggaaatcaaatctgaccgc
ttcgatgccgcgattattgaagacattgttgcagaagggtatttcaaatcaaatgatgac
ctgcaaggctttgtgattcctgatgcgaaagcggaagaagccggttcagcaattgctttc
agaaaggacagtgaactgacagacaaattcaataaagcgctcaaggaaatggaagataac
ggagagcttgagaaattgaagaaaaaatggttcactggcgagaagtaa

DBGET integrated database retrieval system