KEGG   Bacillus subtilis subsp. subtilis 168: BSU23990
Entry
BSU23990          CDS       T00010                                 

Gene name
yqiW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Disulph_isomer DUF3215
Other DBs
NCBI-GeneID: 938683
NCBI-ProteinID: NP_390279
Pasteur: BG11726
BSORF: BG11726
UniProt: P54534 A0A6M4JJ48
Position
complement(2493064..2493501)
AA seq 145 aa
MNMDFNLFMNDIVRQARQEITAAGYTELKTAEEVDEALTKKGTTLVMVNSVCGCAGGIAR
PAAYHSVHYDKRPDQLVTVFAGQDKEATARARDYFEGYPPSSPSFAILKDGKIMKMVERH
EIEGHEPMAVVAKLQEAFEEYCEEV
NT seq 438 nt   +upstreamnt  +downstreamnt
ttgaacatggactttaatttatttatgaatgatattgtccgccaagcgagacaagaaata
acagctgccggatacaccgagcttaaaacagccgaagaggtggatgaggcacttacgaaa
aaaggaacgacgctcgtcatggtaaactctgtttgcggatgcgccggaggaattgcaaga
ccggcagcctaccattccgttcactatgataaaagacctgatcagctcgtcaccgttttt
gccggacaggataaagaagcgacagcgcgtgcgcgtgactattttgaaggttatccacca
tcttctccgtcctttgcgattttgaaagacggaaagatcatgaaaatggtagagcgtcat
gaaattgaaggccatgagccgatggctgtagtggcaaagctgcaggaagcctttgaagaa
tattgtgaagaagtataa

DBGET integrated database retrieval system