KEGG   Bacillus subtilis subsp. subtilis 168: BSU24000
Entry
BSU24000          CDS       T00010                                 

Symbol
bmrU
Name
(RefSeq) lipid kinase BmrU
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DAGK_cat YegS_C NAD_kinase
Other DBs
NCBI-GeneID: 938679
NCBI-ProteinID: NP_390280
Pasteur: BG10302
BSORF: BG10302
UniProt: P39074 A0A6M4JNM8
Position
2493662..2494555
AA seq 297 aa
MSHRKALLIHNGNAGNKNIEKALGAVVPVLSHHLDEVIIKQTKKKDDAYHFCRSIDDSVD
TVFILGGDGTIHQCINAISALERKPAVGILPGGTCNDFSRVLGIPQNLAKAAEALMAGKK
TSVDVCQMNDRYFLNFWGIGLIAETSNQINETEKALLGKISYFTSALRTVSSAASFPMTL
KIDGEEIKEEAVMLLVMNGQYIGTNRIPLPDASIEDGLLDVLICRNTNLTALRELMSMEQ
GSIDRFTGELSYVQASRIEIETDTAKKADMDGEVYTHTPAVIQVLPQHIDMLVPANE
NT seq 894 nt   +upstreamnt  +downstreamnt
atgagccaccggaaagcgttactgattcataacggaaatgccggcaacaaaaatatagaa
aaagcacttggtgctgtggtgccggttttatctcaccatttagatgaggtgattattaaa
cagacaaagaaaaaggatgatgcgtatcatttttgccgatccattgatgattctgtcgac
accgtcttcattctcggcggcgacggcacgatccatcaatgcataaatgctatcagcgct
ctagaaagaaaacccgctgtcggaattttgcccggcggcacgtgcaacgacttttcaaga
gtgcttggcatccctcaaaatcttgcaaaggccgcggaagcacttatggcgggaaaaaaa
accagcgtagacgtatgtcagatgaatgaccgttattttttgaatttctgggggatcggc
ttaattgcagaaacgtcgaatcaaatcaacgaaacggaaaaagcattattgggaaaaatc
agctattttacaagtgccttgcgaaccgtctcatctgctgcatcgtttccgatgacatta
aaaattgatggagaagaaattaaagaagaagccgttatgctgcttgtgatgaatggccaa
tacattggaacgaatcgaattcctctgcccgatgccagtattgaagacggcttacttgat
gttctcatatgccgcaataccaacctcaccgcgctgcgggagctgatgagcatggaacaa
ggctcaattgatcgttttactggagagttgtcctatgtccaggcttcccgtatcgagatt
gaaacagacactgccaaaaaggcggatatggatggagaagtttatacacatacacccgca
gtcattcaggtcctgccacagcatatcgacatgcttgttcccgcaaatgaataa

DBGET integrated database retrieval system