KEGG   Bacillus subtilis subsp. subtilis 168: BSU24010
Entry
BSU24010          CDS       T00010                                 

Symbol
bmr
Name
(RefSeq) multidrug resistance protein
  KO
K19578  MFS transporter, DHA1 family, multidrug resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU24010 (bmr)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BSU24010 (bmr)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_3 OATP DUF3671
Other DBs
NCBI-GeneID: 938680
NCBI-ProteinID: NP_390281
Pasteur: BG10303
BSORF: BG10303
UniProt: P33449 A0A6M4JNE3
Position
2494656..2495825
AA seq 389 aa
MEKKNITLTILLTNLFIAFLGIGLVIPVTPTIMNELHLSGTAVGYMVACFAITQLIVSPI
AGRWVDRFGRKIMIVIGLLFFSVSEFLFGIGKTVEMLFISRMLGGISAAFIMPGVTAFIA
DITTIKTRPKALGYMSAAISTGFIIGPGIGGFLAEVHSRLPFFFAAAFALLAAILSILTL
REPERNPENQEIKGQKTGFKRIFAPMYFIAFLIILISSFGLASFESLFALFVDHKFGFTA
SDIAIMITGGAIVGAITQVVLFDRFTRWFGEIHLIRYSLILSTSLVFLLTTVHSYVAILL
VTVTVFVGFDLMRPAVTTYLSKIAGNEQGFAGGMNSMFTSIGNVFGPIIGGMLFDIDVNY
PFYFATVTLAIGIALTIAWKAPAHLKAST
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggagaagaaaaatattaccttaactatattattaaccaatttatttattgcttttttg
gggatcgggcttgtgattccagtaacgccgaccattatgaatgaattgcatttatcgggg
accgcggtcggctatatggttgcctgcttcgctattacacagctcattgtctcaccaata
gccggacgatgggttgatcgcttcgggcgcaagatcatgatcgtaatcggcctgttgttc
tttagtgtgtcggagtttttgttcggcattggaaaaacagttgagatgttatttatctcc
cgtatgctgggcggtatcagcgcagccttcattatgcccggggtcacggcttttattgca
gatatcacgaccattaaaacacggccaaaagcgctcggttatatgtcagccgctatttca
acaggatttattatcggccccggcatcgggggatttttagcagaagtccattcccggctg
ccttttttctttgcggcagcttttgcactgttagcagccattttatcaatcctcacgctg
cgcgagccggaacgaaaccctgaaaatcaggaaataaaaggacagaagacaggctttaaa
cgaatttttgcccccatgtatttcatagcttttctcattatcttaatttcgtcttttggt
ttagcatcatttgaatctttatttgcattattcgtggatcataaattcggatttacggcc
agcgacattgccattatgattacaggaggagcgattgttggcgccattacgcaagtcgtc
ttattcgaccgcttcacaagatggtttggcgaaattcatttaattcggtacagcttaatt
ctctcgacgagtctggtattcttgctgacaacggtacattcatatgttgcgattctgctg
gtgacagtcaccgtatttgtcggatttgatctcatgcggcctgcggtaacgacttacctg
tcaaagattgcgggaaatgaacaggggtttgccggcggtatgaattcaatgtttacaagt
atcggcaatgtattcgggcctattatcggcggaatgctgttcgatatagatgtaaactat
cctttctactttgcaacggtcaccttagccatagggattgcactgaccattgcttggaaa
gcgcctgcacatcttaaagccagcacgtga

DBGET integrated database retrieval system