KEGG   Bacillus subtilis subsp. subtilis 168: BSU24030
Entry
BSU24030          CDS       T00010                                 

Symbol
bkdB
Name
(RefSeq) lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K09699  2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC:2.3.1.168]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00280  Valine, leucine and isoleucine degradation
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BSU24030 (bkdB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU24030 (bkdB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.168  dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
     BSU24030 (bkdB)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N
Other DBs
NCBI-GeneID: 938677
NCBI-ProteinID: NP_390283
Pasteur: BG10305
BSORF: BG10305
UniProt: P37942 A0A6M3ZDK6
Position
complement(2496796..2498070)
AA seq 424 aa
MAIEQMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITEL
VGEEGQTLQVGEMICKIETEGANPAEQKQEQPAASEAAENPVAKSAGAADQPNKKRYSPA
VLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNPEELKTAAPAPKSASKPE
PKEETSYPASAAGDKEIPVTGVRKAIASNMKRSKTEIPHAWTMMEVDVTNMVAYRNSIKD
SFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQKKDINISIAVATEDSLFVP
VIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFTVNNTGSFGSVQSMGIINYPQ
AAILQVESIVKRPVVMDNGMIAVRDMVNLCLSLDHRVLDGLVCGRFLGRVKQILESIDEK
TSVY
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcaattgaacaaatgacgatgccgcagcttggagaaagcgtaacagaggggacgatc
agcaaatggcttgtcgcccccggtgataaagtgaacaaatacgatccgatcgcggaagtc
atgacagataaggtaaatgcagaggttccgtcttcttttactggtacgataacagagctt
gtgggagaagaaggccaaaccctgcaagtcggagaaatgatttgcaaaattgaaacagaa
ggcgcgaatccggctgaacaaaaacaagaacagccagcagcatcagaagccgctgagaac
cctgttgcaaaaagtgctggagcagccgatcagcccaataaaaagcgctactcgccagct
gttctccgtttggccggagagcacggcattgacctcgatcaagtgacaggaactggtgcc
ggcgggcgcatcacacgaaaagatattcagcgcttaattgaaacaggcggcgtgcaagaa
cagaatcctgaggagctgaaaacagcagctcctgcaccgaagtctgcatcaaaacctgag
ccaaaagaagagacgtcatatcctgcgtctgcagccggtgataaagaaatccctgtcaca
ggtgtaagaaaagcaattgcttccaatatgaagcgaagcaaaacagaaattccgcatgct
tggacgatgatggaagtcgacgtcacaaatatggttgcatatcgcaacagtataaaagat
tcttttaagaagacagaaggctttaatttaacgttcttcgccttttttgtaaaagcggtc
gctcaggcgttaaaagaattcccgcaaatgaatagcatgtgggcgggggacaaaattatt
cagaaaaaggatatcaatatttcaattgcagttgccacagaggattctttatttgttccg
gtgattaaaaacgctgatgaaaaaacaattaaaggcattgcgaaagacattaccggccta
gctaaaaaagtaagagacggaaaactcactgcagatgacatgcagggaggcacgtttacc
gtcaacaacacaggttcgttcgggtctgttcagtcgatgggcattatcaactaccctcag
gctgcgattcttcaagtagaatccatcgtcaaacgcccggttgtcatggacaatggcatg
attgctgtcagagacatggttaatctgtgcctgtcattagatcacagagtgcttgacggt
ctcgtgtgcggacgattcctcggacgagtgaaacaaattttagaatcgattgacgagaag
acatctgtttactaa

DBGET integrated database retrieval system