KEGG   Bacillus subtilis subsp. subtilis 168: BSU24040
Entry
BSU24040          CDS       T00010                                 

Symbol
bkdAB
Name
(RefSeq) 2-oxoisovalerate dehydrogenase subunit beta
  KO
K00167  2-oxoisovalerate dehydrogenase E1 component beta subunit [EC:1.2.4.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00280  Valine, leucine and isoleucine degradation
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BSU24040 (bkdAB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU24040 (bkdAB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.4  3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)
     BSU24040 (bkdAB)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II IMS_C
Other DBs
NCBI-GeneID: 938672
NCBI-ProteinID: NP_390284
Pasteur: BG10306
BSORF: BG10306
UniProt: P37941 A0A6M4JKR4
Position
complement(2498093..2499076)
AA seq 327 aa
MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAE
SAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYG
GGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLI
KGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVY
PLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAM
PYAPTMEKYFMVNPDKVEAAMRELAEF
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtcagtaatgtcatatattgatgcaatcaatttggcgatgaaagaagaaatggaacga
gattctcgcgttttcgtccttggggaagatgtaggaagaaaaggcggtgtgtttaaagcg
acagcgggactctatgaacaatttggggaagagcgcgttatggatacgccgcttgctgaa
tctgcaatcgcaggagtcggtatcggagcggcaatgtacggaatgagaccgattgctgaa
atgcagtttgctgatttcattatgccggcagtcaaccaaattatttctgaagcggctaaa
atccgctaccgcagcaacaatgactggagctgtccgattgtcgtcagagcgccatacggc
ggaggcgtgcacggagccctgtatcattctcaatcagtcgaagcaattttcgccaaccag
cccggactgaaaattgtcatgccatcaacaccatatgacgcgaaagggctcttaaaagcc
gcagttcgtgacgaagaccccgtgctgttttttgagcacaagcgggcataccgtctgata
aagggcgaggttccggctgatgattatgtcctgccaatcggcaaggcggacgtaaaaagg
gaaggcgacgacatcacagtgatcacatacggcctgtgtgtccacttcgccttacaagct
gcagaacgtctcgaaaaagatggcatttcagcgcatgtggtggatttaagaacagtttac
ccgcttgataaagaagccatcatcgaagctgcgtccaaaactggaaaggttcttttggtc
acagaagatacaaaagaaggcagcatcatgagcgaagtagccgcaattatatccgagcat
tgtctgttcgacttagacgcgccgatcaaacggcttgcaggtcctgatattccggctatg
ccttatgcgccgacaatggaaaaatactttatggtcaaccctgataaagtggaagcggcg
atgagagaattagcggagttttaa

DBGET integrated database retrieval system