KEGG   Bacillus subtilis subsp. subtilis 168: BSU24070
Entry
BSU24070          CDS       T00010                                 

Gene name
buk
Definition
(RefSeq) butyrate kinase
  KO
K00929  butyrate kinase [EC:2.7.2.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU24070 (buk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.7  butyrate kinase
     BSU24070 (buk)
SSDB
Motif
Pfam: Acetate_kinase BcrAD_BadFG ROK
Other DBs
NCBI-GeneID: 938675
NCBI-ProteinID: NP_390287
Pasteur: BG11724
BSORF: BG11724
UniProt: P54532 A0A6M4JKJ9
Position
complement(2501549..2502640)
AA seq 363 aa
MKVLHDEKRILTINPGSTSTKIGVFHNERSIFEKTLRHNIEELQRFDRIIDQYEFRKNHI
LETLHEQGINISKFDAVCARGGLLRPIEGGTYVVNDEMIEDLKSGYAGQHASNLGGIIAR
EIADGLNIPSYIVDPVVVDEMSVLAKVSGMPEIERKSIFHALNQKAVARKAAASLGKRYE
NMKMIITHMGGGITIGVHDRGRVVDVNNGLHGEGPFSPERAGTVPAGDLVDLCFSGEYTK
EEIMKKLVGTGGLLGYLGTNDAVKVEQMIQGGDEKARFIYDAMAYQVAKEIGAASAALKG
EVEAIVLTGGLAYGKSFVSAIRSYIDWISDVLVYPGENELQSLAQGALRVLQGEEQSKQY
RIE
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaaagtgctacatgacgaaaaacgcattctcacaattaatccaggctcaacttcaacg
aaaatcggtgtttttcataacgaaagaagcatttttgaaaaaacattgagacacaacata
gaagagctgcagcgatttgaccgaattattgatcagtatgaatttcgtaaaaaccatatt
ctcgaaacgcttcatgaacagggaatcaatatttcaaagtttgatgcagtctgcgcaaga
ggcggccttctccggccaattgaaggcgggacctacgtagtgaatgatgagatgattgag
gatttgaaaagcggctacgccggtcagcatgcttctaatctcggcggcattatcgcgcgg
gaaatcgctgacggcctgaatatcccttcgtatatcgtcgaccctgttgtcgtagacgaa
atgtcagtgcttgcgaaagtttcaggcatgcctgaaattgaaaggaaaagcattttccat
gcgttaaaccaaaaagctgtcgctcgtaaagcggcagcctcccttggcaaacgatatgag
aacatgaaaatgattattacccatatgggcggaggtattacaattggcgtccatgaccgc
gggcgagtggtggatgtcaataacggcctgcacggcgagggaccattcagtcctgaacga
gcaggaacagtgcctgcgggagatcttgttgatctatgtttttcaggggaatatacaaaa
gaagaaatcatgaaaaagcttgttggcaccggcggacttttaggctatctcggtacaaat
gatgcagtaaaagtggaacagatgattcaagggggcgatgaaaaagcccgcttcatttat
gatgccatggcatatcaggtagcaaaggaaatcggggcagccagcgcggcgttaaaaggc
gaagttgaagcgattgtgctgacgggaggccttgcgtacggaaaaagctttgtttctgct
atcagatcatacatagattggatttcagacgttttagtttatccgggtgaaaatgaactg
cagtctcttgcccaaggggcgctaagagtattgcagggcgaagagcaatccaaacaatat
cgtattgaatag

DBGET integrated database retrieval system