KEGG   Bacillus subtilis subsp. subtilis 168: BSU24090
Entry
BSU24090          CDS       T00010                                 

Gene name
ptb
Definition
(RefSeq) phosphate butyryltransferase
  KO
K00634  phosphate butyryltransferase [EC:2.3.1.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU24090 (ptb)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     BSU24090 (ptb)
SSDB
Motif
Pfam: PTA_PTB
Other DBs
NCBI-GeneID: 938671
NCBI-ProteinID: NP_390289
Pasteur: BG11722
BSORF: BG11722
UniProt: P54530 A0A6M3ZH16
Position
complement(2503765..2504664)
AA seq 299 aa
MKLKDLIGKASIHKNKTIAVAHAEDEEVIRAVKLAAEHLSARFLLTGDSKKLNELTSSMQ
GHQVEIVHANTPEESAKLAVRAVHHKTADVLMKGNVPTSVLLKAVLNRQEGLRSASVLSH
VAVFDIPDFDRLMFVTDSAMNIAPSLEELRQILQNAVHVAHAVGNNMPKAAALAAVETVN
PKMEATVNAAALAQMYKRGQIKGCIVDGPLALDNAVSQIAAAQKKISGDVAGNADILLVP
TIEAGNILYKSLIYFAKASVAAVITGAKAPIALTSRADSAENKLYSIALAICASEEYTH
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaagctgaaagatttaatcggcaaagcgtcgatacacaaaaataagaccattgcggtt
gctcatgctgaggatgaggaagtgatccgggctgtaaagctggcagccgagcacctatcc
gcccgtttcttgttaacgggcgacagcaaaaaactgaacgagctgacatcatccatgcaa
gggcatcaagtggaaatcgtccatgccaatactcctgaggaatcggcgaaattagcggtt
cgtgctgtgcatcataaaacagcggacgttttaatgaaaggcaatgtgccgacttctgtt
ttgcttaaagcggtattgaacagacaggaggggcttcggtcagcaagtgtcctttctcac
gtggctgtcttcgatataccggattttgaccggctgatgtttgtgacagattcggcaatg
aatattgctccttcgctggaagagctccggcagattttgcaaaatgccgttcatgtggcc
catgcagtggggaacaatatgccaaaagcagctgcccttgcagcggtcgaaacggtgaac
cctaaaatggaagcgaccgtgaatgcagctgctctagctcaaatgtacaaaaggggccag
atcaaaggctgcattgttgatggaccgcttgctttggataacgcagtttcacaaattgcc
gcggcccagaaaaaaatttcgggagacgtagcgggcaacgcagatatccttctcgtccca
acaattgaggccggcaatattttatataaatcactgatttattttgccaaggccagcgtg
gcggctgtcattacaggagcaaaagcaccgattgctttaacaagcagagcggactctgct
gaaaataaactgtattccattgcgctggcaatatgcgcatctgaagaatacacacattag

DBGET integrated database retrieval system