KEGG   Bacillus subtilis subsp. subtilis 168: BSU24110
Entry
BSU24110          CDS       T00010                                 

Symbol
yqzF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2627 PMP22_Claudin
Other DBs
NCBI-GeneID: 938667
NCBI-ProteinID: NP_390291
Pasteur: BG13772
BSORF: BG13772
UniProt: O32015 A0A6M3ZIX3
Position
2507020..2507256
AA seq 78 aa
MSRLLALLILVIPGAISALGIKLMRDTLFGHTIKPFSALWLQGLSGFIFFAIGLYVLAGF
ILYRDRKRNQVSPRFRKR
NT seq 237 nt   +upstreamnt  +downstreamnt
atgagccgacttcttgcgcttttaatattagtcatccccggggctatttctgctttaggc
attaaactgatgagagatacacttttcggccatacaatcaagccattttcagctctttgg
ctccaagggttgtcaggattcatcttttttgcgatcggcctctatgtgctggccgggttc
attttatacagagacagaaaacgcaatcaagtcagcccgcgattcagaaaacgatag

DBGET integrated database retrieval system