KEGG   Bacillus subtilis subsp. subtilis 168: BSU24120
Entry
BSU24120          CDS       T00010                                 

Gene name
prpB
Definition
(RefSeq) methylisocitrate lyase
  KO
K03417  methylisocitrate lyase [EC:4.1.3.30]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BSU24120 (prpB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.30  methylisocitrate lyase
     BSU24120 (prpB)
SSDB
Motif
Pfam: PEP_mutase ICL Pantoate_transf
Other DBs
NCBI-GeneID: 938668
NCBI-ProteinID: NP_390292
Pasteur: BG11720
BSORF: BG11720
UniProt: P54528 A0A6M3ZE80
Position
complement(2507298..2508203)
AA seq 301 aa
MSWIVNKQSSQEELAGRFRKLMSAPDILQIPGAHDGMAALLAKEAGFSAIYLSGAAYTAS
RGLPDLGIITSAEIAERAKDLVRAADLPLLVDIDTGFGGVLNAARTAREMLEARVAAVQM
EDQQLPKKCGHLNGKQLVPIKEMAQKIKAIKQAAPSLIVVARTDARAQEGLDAAIKRSEA
YIEAGADAIFPEALQAENEFRQFAERIPVPLLANMTEFGKTPYYRADEFEDMGFHMVIYP
VTSLRAAAKACERMFGLMKEHGSQKEGLHDMQTRKELYDTISYYDYEALDKTIAKTVLPD
E
NT seq 906 nt   +upstreamnt  +downstreamnt
atgtcgtggatcgtcaataagcaatcgtcacaagaggagcttgccgggcgtttccgcaag
ctgatgtcagcaccggacattcttcaaattcccggcgcccatgacgggatggccgctttg
cttgcgaaagaagccggtttttctgctatttatttgtccggtgctgcctatacagccagc
agggggctgcctgatttagggatcatcacatcggcagagatagctgaacgggccaaagat
cttgtgcgtgcagctgatctgcctttgcttgtggatatcgatacgggatttggcggtgtc
ttaaatgccgcccgaacagcccgggagatgcttgaagccagggtagcagccgttcaaatg
gaagaccagcagctcccaaaaaaatgcggacatttaaatggcaaacagctagttccgata
aaggaaatggcgcaaaaaataaaagccattaaacaagcggcaccctcccttattgttgtt
gcccgtactgatgccagggcgcaggaagggcttgatgccgcaataaaacgttcagaggct
tacattgaggcgggagcggacgcaattttcccggaagcgctacaggcggagaatgaattc
cgccagtttgctgagcgtatccccgttccgctccttgcgaatatgactgaatttgggaaa
acgccatattatcgtgccgatgaattcgaagatatggggtttcacatggtgatatatcct
gtcacctcgcttcgagcggcggcaaaagcttgtgagcggatgtttggtttgatgaaggag
cacggctcacaaaaagaaggacttcatgatatgcagacacgaaaagaactgtacgatacg
atttcttattatgactatgaagcgttagacaaaacgattgccaagaccgttttgcctgac
gaataa

DBGET integrated database retrieval system