KEGG   Bacillus subtilis subsp. subtilis 168: BSU24130
Entry
BSU24130          CDS       T00010                                 

Symbol
prpD
Name
(RefSeq) 2-methylcitrate dehydratase
  KO
K01720  2-methylcitrate dehydratase [EC:4.2.1.79]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BSU24130 (prpD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.79  2-methylcitrate dehydratase
     BSU24130 (prpD)
SSDB
Motif
Pfam: MmgE_PrpD MmgE_PrpD_C
Other DBs
NCBI-GeneID: 938663
NCBI-ProteinID: NP_390293
Pasteur: BG11323
BSORF: BG11323
UniProt: P45859 A0A6M3ZDM0
Structure
Position
complement(2508221..2509639)
AA seq 472 aa
MPKTDRVIEEITDYVLEKEITSAEAYTTAGHVLLDTLGCGILALRYPECTKLLGPIVPGT
TVPNGSKVPGTSYVLDPVRAAFNIGCMIRWLDYNDTWLAAEWGHPSDNLGGILAAADYVS
RVRLSEGKEPLTVRDVLEMMIKAHEIQGVLALENSLNRVGLDHVLFVKVATTAVAAKLLG
GGREEIKNALSNAWIDNAALRTYRHSPNTGSRKSWAAGDATSRGVHLALMSLKGEMGYPT
ALSAPGWGFQDVLFNKKEIKLARPLDAYVMENVLFKVSYPAEFHAQTAAESAVILHPQVK
NRIDEIDRVVIRTHESAIRIIDKKGPLHNPADRDHCLQYITAIGLLFGDITAQHYEAETA
NDPRIDKLRDKMEVTENKTYTEDYLKPDKRSISNAVQVHFKDGTSTEMVECEFPLGHRFR
REEAVPKLLEKFSDNLKTHFPDKQHKHIYERCTSYETLQTMRVNEFVDMFCM
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgccgaaaacggatcgtgttatcgaagaaatcacagactatgtgcttgagaaagagatt
actagtgccgaagcgtatacaacagcggggcatgtattgctggataccctgggctgcgga
atcttggcgctacggtatccggaatgcacaaagctgcttggcccgattgttccaggaacg
actgtgccgaatggaagcaaagtgccgggaacgtcatatgttctcgatcctgtgagggca
gcgtttaatattggctgcatgattcgctggctcgattacaacgatacgtggctggcggcg
gagtgggggcatccatccgataacttgggaggaatccttgccgctgctgattatgtatca
agagtgaggctgtctgaaggaaaagagccgttaacggtacgcgacgtacttgagatgatg
atcaaagcacacgagatccaaggtgtgctggcgttagaaaacagcttaaatcgagttggc
cttgaccatgtgctgtttgtcaaagttgcgacaactgctgttgcagcaaagcttttgggc
ggcggaagagaagaaatcaaaaatgcgctttcgaatgcatggattgacaatgcagcattg
aggacataccgccattcaccgaatacaggctcgcgtaaatcatgggcggcaggagatgca
acgagcagaggtgttcatttggcgctgatgtcgttaaaaggggaaatgggttatccgaca
gccttgagtgcaccgggttgggggttccaagacgttttattcaataagaaagagatcaag
cttgcccgtccgctcgacgcttatgtcatggaaaatgtgttatttaaagtgtcttatcct
gcggaatttcacgcccagacagcggcggagtccgccgtcattcttcacccgcaggtaaag
aaccggattgacgagattgaccgagttgtcatcagaacgcatgaatcagctatccgaatc
attgataaaaaaggcccgctccacaatccggcagaccgtgatcactgcctccaatacatt
acagcaatcggtttgctttttggtgatatcaccgcacagcattatgaagctgaaacagcg
aatgatccgagaatagataaacttcgtgataaaatggaagtgactgaaaataaaacatat
accgaggattatttgaagcctgataaacgctccatctcaaatgccgttcaggttcatttt
aaagatggaacgagcacggaaatggtggaatgtgagtttcccctcggccatcgttttcga
agagaggaagcagtgccgaaactgctggaaaagttttctgacaatctcaaaacccatttt
cctgataaacagcacaaacacatttatgagcgctgtaccagctatgagacattacaaacg
atgcgcgtaaatgaattcgtagacatgttctgcatgtaa

DBGET integrated database retrieval system