KEGG   Bacillus subtilis subsp. subtilis 168: BSU24140
Entry
BSU24140          CDS       T00010                                 

Symbol
mmgD
Name
(RefSeq) 2-methylcitrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU24140 (mmgD)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU24140 (mmgD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     BSU24140 (mmgD)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-GeneID: 938665
NCBI-ProteinID: NP_390294
Pasteur: BG11322
BSORF: BG11322
UniProt: P45858 A0A6M3ZDW2
Position
complement(2509654..2510772)
AA seq 372 aa
MEEKQHYSPGLDGVIAAETHISYLDTQSSQILIRGYDLIELSETKSYLELVHLLLEGRLP
EESEMETLERKINSASSLPADHLRLLELLPEDTHPMDGLRTGLSALAGYDRQIDDRSPSA
NKERAYQLLGKMPALTAASYRIINKKEPILPLQTLSYSANFLYMMTGKLPSSLEEQIFDR
SLVLYSEHEMPNSTFAARVIASTHSDLYGALTGAVASLKGNLHGGANEAVMYLLLEAKTT
SDFEQLLQTKLKRKEKIMGFGHRVYMKKMDPRALMMKEALQQLCDKAGDHRLYEMCEAGE
RLMEKEKGLYPNLDYYAAPVYWMLGIPIPLYTPIFFSARTSGLCAHVIEQHANNRLFRPR
VSYMGPRYQTKS
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggaggagaaacagcattattctccagggttggacggtgtgattgcggcagaaactcat
atttcttatcttgacacgcagtccagccagattttgataagaggctatgatttaatagaa
ctttctgaaacaaaaagctatctggagcttgtccatttattgctggagggcaggctgcca
gaagaaagtgaaatggaaacgctggaacgtaaaataaacagtgcctcaagcctgcctgct
gatcatctccgtctgcttgagctgctccctgaggacactcatccaatggatggtctgcgt
accggcctgtcggcacttgctggctatgatcggcaaattgatgatcggtctccttccgca
aacaaagaacgcgcctatcagcttcttgggaaaatgcctgccctcactgctgccagctac
aggatcattaataagaaagaaccgattcttccgcttcaaaccctatcctacagtgcgaat
tttctctacatgatgacagggaaattgccgtcttcattggaagaacagatttttgaccgg
tcgctcgtcctgtacagtgagcatgagatgccgaattcaacctttgcggccagggtcatt
gcatctacacattcagatctttatggggctttgactggggctgtcgcttccctgaaaggg
aatcttcacggaggagcaaacgaagctgtgatgtatttgcttttggaggcaaaaacgaca
tctgattttgagcagcttttgcaaacaaaactgaaaagaaaagaaaaaatcatgggcttc
ggccaccgggtgtatatgaaaaaaatggacccgagagcactcatgatgaaagaggcgctg
cagcaattatgcgataaagccggtgaccatcgtttatatgagatgtgcgaagcgggtgag
cggctgatggagaaggaaaaagggctttacccgaatttggattactatgctgccccagtg
tattggatgctcggcataccgattcctttatatacgccgatctttttcagcgcgagaacg
tccggtttatgcgcccatgtgatcgaacagcatgccaataatcggctcttccgtccccgt
gtcagttacatgggcccgcgatatcaaacaaaatcatga

DBGET integrated database retrieval system