KEGG   Bacillus subtilis subsp. subtilis 168: BSU24150
Entry
BSU24150          CDS       T00010                                 

Symbol
mmgC
Name
(RefSeq) acyl-CoA dehydrogenase
  KO
K18244  acyl-CoA dehydrogenase [EC:1.3.99.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU24150 (mmgC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     BSU24150 (mmgC)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M Vesi_VP2
Other DBs
NCBI-GeneID: 938664
NCBI-ProteinID: NP_390295
Pasteur: BG11321
BSORF: BG11321
UniProt: P45857 A0A6M4JKS6
Structure
Position
complement(2510806..2511945)
AA seq 379 aa
MHVTQEQVMMRKMVRDFARKEIAPAAEIMEKTDEFPFQLIKKMGKHGLMGIPVPEQYGGA
GADVVSYILAIHEISRISAAVGVILSVHTSVGTNPILYFGNEEQKMKYIPNLASGDHLGA
FALTEPHSGSDAGSLRTTAIKKNGKYLLNGSKIFITNGGAADIYITFALTAPDQGRHGIS
AFIVEKNTPGFTVGKKERKLGLYGSNTTELIFDNAEVPEANLLGKEGDGFHIAMANLNVG
RIGIAAQALGIAEAALEHAVDYAKQRVQFGRPIAANQGISFKLADMATRAEAARHLVYHA
ADLHNRGLNCGKEASMAKQFASDAAVKAALDAVQIYGGYGYMKDYPVERLLRDAKVTQIY
EGTNEIQRLIISKYLLGGT
NT seq 1140 nt   +upstreamnt  +downstreamnt
ttgcatgtaacccaagagcaagtcatgatgcgaaaaatggtgcgtgattttgcacgaaaa
gaaattgctcccgctgcggaaatcatggagaaaacggacgaatttccctttcagctgatc
aaaaaaatgggtaaacacggactgatgggaataccggtgccggaacaatacggcggtgct
ggagcggacgttgtttcttatattttggcaattcatgagatttctagaatcagcgcggct
gtcggcgtgattctctccgttcatacctcagtcggcacgaatccgattctgtatttcggc
aacgaagaacagaagatgaaatatataccaaatctcgcgtcaggagaccatttgggcgca
tttgcactaacggagcctcactcggggtcggatgccgggagcctccgcacaacagcaatc
aaaaagaacggcaaatacctattaaacggatcgaaaatattcataacgaatggcggagca
gctgatatctatatcacatttgctttaacagctccagatcaaggcaggcacgggatttcg
gcttttattgttgaaaaaaacacacccggttttaccgttggaaaaaaagaaagaaagctg
gggctttatggctccaatactacggaactgatttttgataatgcagaagtgcctgaagcc
aatttgcttggcaaagagggggatggctttcacattgccatggcgaatttaaatgtcggc
cggatcggcattgcggcacaggccctcggaattgcagaggcggctcttgagcatgccgtt
gattatgcgaagcagcgagtgcaatttggaaggccgattgcagccaatcaaggcatatca
tttaagctggctgatatggcgactagagctgaggcggcaagacatcttgtctaccacgct
gcagaccttcataaccgcggcctaaactgtggaaaagaagcgtctatggctaaacaattt
gcttccgatgcagccgtaaaggcggcgttagacgccgttcaaatttatgggggatatggc
tatatgaaggattatccagttgagcgcctgcttcgcgatgcaaaggtgacgcaaatttat
gaagggacgaacgagattcaaagactgattatttccaagtatttgcttggcggaacctga

DBGET integrated database retrieval system