KEGG   Bacillus subtilis subsp. subtilis 168: BSU24160
Entry
BSU24160          CDS       T00010                                 

Gene name
mmgB
Definition
(RefSeq) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00360  Phenylalanine metabolism
bsu00362  Benzoate degradation
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU24160 (mmgB)
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BSU24160 (mmgB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSU24160 (mmgB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     BSU24160 (mmgB)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 NAD_Gly3P_dh_N AlaDh_PNT_C F420_oxidored 2-Hacid_dh_C XdhC_C ApbA Mannitol_dh
Other DBs
NCBI-GeneID: 938660
NCBI-ProteinID: NP_390296
Pasteur: BG11320
BSORF: BG11320
UniProt: P45856 A0A6M3ZDH1
Position
complement(2511973..2512836)
AA seq 287 aa
MEIKQIMVAGAGQMGSGIAQTAADAGFYVRMYDVNPEAAEAGLKRLKKQLARDAEKGKRT
ETEVKSVINRISISQTLEEAEHADIVIEAIAENMAAKTEMFKTLDRICPPHTILASNTSS
LPITEIAAVTNRPQRVIGMHFMNPVPVMKLVEVIRGLATSEETALDVMALAEKMGKTAVE
VNDFPGFVSNRVLLPMINEAIYCVYEGVAKPEAIDEVMKLGMNHPMGPLALADFIGLDTC
LSIMEVLHSGLGDSKYRPCPLLRKYVKAGWLGKKSGRGFYDYEEKTS
NT seq 864 nt   +upstreamnt  +downstreamnt
atggaaatcaaacaaatcatggtagctggcgcaggtcagatggggagcggaattgctcaa
acagccgccgacgcgggcttttatgtgcggatgtatgatgtgaatccagaggccgcggag
gcaggattgaaacggctgaagaaacagctggcccgtgatgctgagaaaggaaaaaggacc
gagacggaagtgaagagcgtaatcaaccgcatttcgatttctcaaacacttgaggaggca
gagcatgcggacattgtgattgaggctatcgcagaaaacatggcggcaaaaactgagatg
tttaaaacacttgatcgcatttgcccgcctcatacgattttggccagcaatacatcttcc
ttgcctattacagaaatcgctgctgtaacaaaccggcctcaacgggttattggcatgcat
tttatgaatcccgtccctgtaatgaagctggtagaagtgattcgaggcttggctacatca
gaagaaacggccttagatgttatggcattagcggaaaagatggggaaaacagcggtagaa
gtcaatgattttcctgggtttgtttccaaccgtgtgcttcttccaatgattaatgaagcc
atctattgcgtgtatgagggagtggcgaagccggaggcaatagatgaagtgatgaagctg
ggcatgaatcatccgatgggtccgcttgcattagcggattttatcggactggatacgtgt
ttatcaattatggaagtccttcactcaggccttggcgattccaaataccgtccttgcccg
ctgctccgcaagtatgtcaaagcaggctggcttggcaaaaagagcggacgcggtttttat
gactatgaggagaagacttcctga

DBGET integrated database retrieval system