KEGG   Bacillus subtilis subsp. subtilis 168: BSU24190
Entry
BSU24190          CDS       T00010                                 

Gene name
yqiI
Definition
(RefSeq) hypothetical protein
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BSU24190 (yqiI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU24190 (yqiI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU24190 (yqiI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU24190 (yqiI)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   BSU24190 (yqiI)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BSU24190 (yqiI)
SSDB
Motif
Pfam: Amidase_3
Other DBs
NCBI-GeneID: 938657
NCBI-ProteinID: NP_390299
Pasteur: BG11717
BSORF: BG11717
UniProt: P54525 A0A6M3ZH26
Position
complement(2514979..2515599)
AA seq 206 aa
MRMLWRSLALCGLALTLAPCAQAAEPIEGKTVYIDAGHGGEDSGAVGNGLFEKDINLAVS
EHVTDKLKEEGANPVASRSDDHFLTLEERVAKASANQADLFVSIHVNSGVASASGTETYF
QSDYEGENSRRLASDIQSQLVSSLQTRDRGVKESDFYVITYSQMPSVLAELGFITNSSDA
DKLGSEEYQQKAADAIVNGIDSYYDQ
NT seq 621 nt   +upstreamnt  +downstreamnt
ttgagaatgttatggaggagcttggcgctgtgcggattggctttgacgctcgcgccttgt
gcacaggcagcagagccgatagaagggaaaacagtgtatattgatgccggacacggcggt
gaagacagtggagcggtcggaaacgggctctttgaaaaggatattaatttggctgtctca
gagcatgtgacagacaaactaaaagaggagggagccaatcctgttgcatcccggtctgac
gatcattttctgaccttggaggaaagagtggctaaggcaagtgccaatcaggctgacctt
tttgtcagcattcatgtgaattcaggggttgcttcagcttcaggaacagaaacgtatttt
caatctgattatgaaggggagaacagccggcgtctggcatccgatattcagtcacagctc
gtttcttccttacaaacgagagacaggggcgtgaaagaatcagacttttacgtcattaca
tattcacaaatgccaagtgtgttggcggagcttgggtttatcacgaacagctctgacgcg
gacaagctgggaagtgaagaataccagcaaaaggccgcagatgcgattgtcaatggcatt
gattcttattatgatcagtag

DBGET integrated database retrieval system