KEGG   Bacillus subtilis subsp. subtilis 168: BSU24200
Entry
BSU24200          CDS       T00010                                 

Gene name
yqiH
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LPAM_1 DUF1344 LPAM_2
Other DBs
NCBI-GeneID: 938658
NCBI-ProteinID: NP_390300
Pasteur: BG11030
BSORF: BG11030
UniProt: P40770 A0A6M3ZDV6
Position
complement(2515614..2515907)
AA seq 97 aa
MKQTVLLLFTALFLSGCSVASADDSVPRFTEEGKYIGSADPHTIAVSLNGEETMIQVPKD
KRDECESLPDQTHVLVKYTKKDNGTLQLEDIQLRKNS
NT seq 294 nt   +upstreamnt  +downstreamnt
gtgaaacaaacggttcttttgctgtttactgcgctctttctttcggggtgcagtgttgca
agtgcggatgactcagtgccgaggtttaccgaagagggaaaatacattggctcggctgat
cctcatacgattgcggtttctcttaatggagaagaaaccatgatacaagttccgaaggat
aaacgtgatgaatgtgaatcactgccagatcagacacatgtcctggtgaaatatacaaag
aaggataatggaactttacagctggaagatattcagctgcgaaagaactcgtga

DBGET integrated database retrieval system