KEGG   Bacillus subtilis subsp. subtilis 168: BSU24230
Entry
BSU24230          CDS       T00010                                 

Gene name
spoIVB
Definition
(RefSeq) peptidase S55
  KO
K06399  stage IV sporulation protein B [EC:3.4.21.116]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU24230 (spoIVB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.116  SpoIVB peptidase
     BSU24230 (spoIVB)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S55: SpoIVB peptidase family
   BSU24230 (spoIVB)
SSDB
Motif
Pfam: Peptidase_S55 PDZ_6 PDZ PDZ_2 Tricorn_PDZ LMWPc
Other DBs
NCBI-GeneID: 938654
NCBI-ProteinID: NP_390303
Pasteur: BG10311
BSORF: BG10311
UniProt: P17896 A0A6M4JIY6
Position
complement(2519102..2520382)
AA seq 426 aa
MPDNIRKAVGLILLVSLLSVGLCKPLKEYLLIPTQMRVFETQTQAIETSLSVNAQTSESS
EAFTVKKDPHEIKVTGKKSGESELVYDLAGFPIKKTKVHVLPDLKVIPGGQSIGVKLHSV
GVLVVGFHQINTSEGKKSPGETAGIEAGDIIIEMNGQKIEKMNDVAPFIQKAGKTGESLD
LLIKRDKQKIKTKLIPEKDEGEGKYRIGLYIRDSAAGIGTMTFYEPKTKKYGALGHVISD
MDTKKPIVVENGEIVKSTVTSIEKGTGGNPGEKLARFSSERKTIGDINRNSPFGIFGTLH
QPIQNNISDQALPVAFSTEVKKGPAEILTVIDDDKVEKFDIEIVSTTPQKFPATKGMVLK
ITDPRLLKETGGIVQGMSGSPIIQNGKVIGAVTHVFVNDPTSGYGVHIEWMLSEAGIDIY
GKEKAS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgcccgataacatcagaaaagcagtaggtttaattctccttgtttcgttattaagtgta
ggtttatgcaaaccgctaaaagaatatttactgattccaacgcaaatgagagtatttgaa
acccaaacacaagcgattgaaacgagtttatcggtaaacgctcagacatcagaatcctca
gaagcgtttacagtaaagaaagatccgcatgaaatcaaggtgacgggcaaaaaatcaggt
gagtcagaattggtatatgatcttgccggatttccaattaaaaaaacaaaagtgcatgtt
cttcctgatttaaaagttatacctggcggacaatcaatcggtgtaaaacttcattccgtc
ggtgttcttgtcgtcggatttcatcaaatcaatacaagtgaaggcaaaaaatctccggga
gaaacggcaggaattgaagcgggcgacatcattattgagatgaatggacagaaaattgaa
aaaatgaatgatgtagccccatttattcaaaaggctgggaaaactggtgaatctttagac
ttactgatcaaacgtgataaacagaaaatcaaaacgaagctgatcccagaaaaggatgaa
ggagaaggcaaatacagaatcgggttatatatcagagattctgctgctggcatcggcact
atgaccttttatgaaccgaaaacaaaaaaatacggagcacttggccacgtgatttccgat
atggacacaaagaaaccaattgtagtggagaatggagaaatcgttaaatccactgtaaca
tcaattgaaaaagggacaggcggtaatccgggagaaaaactggcgcgattttcctcagaa
cgcaaaacgatcggggatattaacagaaacagcccgtttgggattttcggcacactgcat
cagccgattcaaaacaacatatcagatcaagcattgccggttgcgttttctaccgaagtc
aaaaaagggccggctgaaattttaacggttattgatgatgacaaagtagaaaaattcgat
attgaaatcgtcagcacaacgccgcaaaaattccctgcgacaaaaggaatggtgttgaaa
attaccgatccaagactgttgaaagaaacaggaggcatcgtacaggggatgagcggaagc
ccgatcattcaaaatggaaaagtgatcggtgctgtcacccatgtatttgtaaatgacccg
acaagcggctacggtgttcatattgaatggatgctgtcagaagcaggaatcgatatttat
ggaaaagaaaaagcaagctga

DBGET integrated database retrieval system