KEGG   Bacillus subtilis subsp. subtilis 168: BSU24240
Entry
BSU24240          CDS       T00010                                 

Symbol
recN
Name
(RefSeq) DNA repair protein RecN
  KO
K03631  DNA repair protein RecN (Recombination protein N)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU24240 (recN)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BSU24240 (recN)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BSU24240 (recN)
SSDB
Motif
Pfam: AAA_23 SMC_N AAA_29 AAA_21 AAA_15 HOOK DUF1664 AAA_22 Nup54_57_C RsgA_GTPase FlpD ABC_tran ISG65-75 Mod_r MutS_V Allexi_40kDa DUF4164 Baculo_PEP_C
Other DBs
NCBI-GeneID: 938656
NCBI-ProteinID: NP_390304
Pasteur: BG10310
BSORF: BG10310
UniProt: P17894 A0A6M3ZE27
Position
complement(2520557..2522287)
AA seq 576 aa
MLAELSIKNFAIIEELTVSFERGLTVLTGETGAGKSIIIDAISLLVGGRGSSEFVRYGEA
KAELEGLFLLESGHPVLGVCAEQGIDVSDEMIVMRRDISTSGKSVCRVNGKLVTIASLRE
IGRLLLDIHGQHDNQLLMEDENHLQLLDKFAGAEVESALKTYQEGYQRYVKLLKKLKQLS
ESEQEMAHRLDLIQFQLEEIESAKLELNEDEQLQEERQQISNFEKIYESLQNAYNALRSE
QGGLDWVGMASAQLEDISDINEPLKKMSESVSNSYYLLEDATFQMRNMLDELEFDPERLN
YIETRLNEIKQLKRKYGATVEDILEYASKIEEEIDQIENRDSHLQSLKKELDSVGKDVAV
EAANVSQIRKTWAKKLADEIHRELKSLYMEKSTFDTEFKVRTASRNEEAPLVNGQPVQLT
EQGIDLVKFLISTNTGEPLKSLSKVASGGELSRVMLAIKSIFSSQQDVTSIIFDEVDTGV
SGRVAQAIAEKIHKVSIGSQVLCITHLPQVAAMADTHLYIAKELKDGRTTTRVKPLSKQE
KVAEIGRMIAGVEVTDLTKRHAKELLKQADQVKTTG
NT seq 1731 nt   +upstreamnt  +downstreamnt
ttgttagctgaactatcgattaaaaactttgccattattgaggaactgacggtttctttt
gaacgcgggcttacggttttaacaggagaaaccggagccggcaaatccatcatcatagat
gccatttctcttttagtcggaggccgcggatcatctgaatttgttagatatggggaagca
aaagccgaacttgaagggctgtttctgttggagagcggccatcctgttttaggcgtatgc
gctgagcagggaatcgacgtttcagacgaaatgatcgtcatgagaagggatatcagcacg
agcgggaaaagcgtttgccgtgtcaatggcaagcttgtcacgattgcttcactaagagag
atcggcaggcttttattagatattcacgggcagcacgataaccagctgttaatggaagac
gaaaatcatctccagcttttggacaagtttgccggggccgaagtggaaagcgcgctcaaa
acgtatcaggaagggtaccagcggtatgtgaagctgctcaaaaagcttaagcagctttct
gaaagcgaacaggaaatggcccatcgtcttgatcttattcaatttcagctcgaagaaatc
gaatcggcaaagcttgagcttaacgaagatgaacagctccaagaagagcgccagcaaatt
tcaaactttgagaagatatatgagtcgctgcaaaatgcatataacgcgcttcgcagtgag
cagggcggattggactgggttggaatggcatcagcgcagcttgaagatatatctgatata
aacgaaccgctgaaaaaaatgtctgaaagtgtttcgaactcctactatttgcttgaggat
gccacatttcagatgagaaatatgctggatgagcttgaatttgatccggaacgcctgaac
tatattgagacgcgacttaatgaaatcaaacagctgaaacgaaaatacggtgccactgtt
gaagacattttggaatatgcttctaaaattgaagaagagattgaccaaattgaaaacagg
gacagccaccttcaaagcttgaaaaaggagcttgactccgtcggcaaagatgtcgcagtg
gaagcggcaaatgtgtcacaaatccgaaaaacatgggcgaaaaagctggctgatgagatt
catcgggaattaaaaagcctgtacatggaaaaatcaacttttgatacggaatttaaggtc
agaacagcgtcacgcaatgaagaggcgccgcttgtaaacggccagcccgttcagctgact
gaacaagggattgacctggtgaagtttttaatttcaaccaatacaggcgagccgctgaaa
tccctttcgaaagtcgcttcaggtggagagctgtcacgggtgatgcttgccataaaaagc
attttttcctcacaacaggatgtgacatcgatcatttttgacgaggttgataccggtgta
agcggcagggtcgcacaggcaattgctgagaagatccataaggtgtcaataggatcacaa
gtgctgtgcattacacacctgcctcaggtggctgccatggccgatacgcatctttatatt
gcgaaggagttaaaagacggcagaacgacgacacgtgtcaagccgctctctaagcaggaa
aaggtagcggaaatcgggcgcatgattgcaggtgtcgaagtaaccgacttaacgaaacgc
catgcgaaagaacttttaaaacaagcggatcaagtcaaaacaactgggtaa

DBGET integrated database retrieval system