KEGG   Bacillus subtilis subsp. subtilis 168: BSU24250Help
Entry
BSU24250          CDS       T00010                                 

Gene name
ahrC
Definition
(RefSeq) arginine repressor
  KO
K03402  transcriptional regulator of arginine metabolism
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU24250 (ahrC)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU24250 (ahrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arg_repressor Arg_repressor_C SF3b1
Motif
Other DBs
NCBI-GeneID: 938653
NCBI-ProteinID: NP_390305
Pasteur: BG10309
BSORF: BG10309
UniProt: P17893
Structure
PDB: 

Position
complement(2522324..2522773)
Genome map
AA seq 149 aa AA seqDB search
MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSY
KYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMG
TICGDDTILIICRTPEDTEGVKNRLLELL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaggccagaggcatattaaaatcagagagatcattacaagcaatgaaatcgaa
acgcaggatgaattggtcgacatgctaaagcaggatggatacaaagtaacgcaggccacg
gtatcacgggatattaaagaacttcaccttgtaaaagtgcctacaaataatggttcttac
aaatacagtcttccggcggaccagcgtttcaatccgctgtcaaagctaaagcgggcattg
atggacgcatttgtgaaaatagactcagcaagccatatgattgtgctgaaaacgatgccg
ggcaatgcccaggcaatcggggcgctgatggacaatttggactgggatgaaatgatgggg
accatttgcggagatgatacgattttaattatttgccggactcctgaagatacagaaggc
gtaaaaaacaggctccttgaactgctgtaa

DBGET integrated database retrieval system