KEGG   Bacillus subtilis subsp. subtilis 168: BSU24270Help
Entry
BSU24270          CDS       T00010                                 

Gene name
dxs
Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Module
bsu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU24270 (dxs)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU24270 (dxs)
Enzymes [BR:bsu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     BSU24270 (dxs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C Transketolase_N TPP_enzyme_C PFOR_II DUF2188 DUF987 E1_dh
Motif
Other DBs
NCBI-GeneID: 938609
NCBI-ProteinID: NP_390307
Pasteur: BG11715
BSORF: BG11715
UniProt: P54523
Position
complement(2523713..2525614)
Genome map
AA seq 633 aa AA seqDB search
MDLLSIQDPSFLKNMSIDELEKLSDEIRQFLITSLSASGGHIGPNLGVVELTVALHKEFN
SPKDKFLWDVGHQSYVHKLLTGRGKEFATLRQYKGLCGFPKRSESEHDVWETGHSSTSLS
GAMGMAAARDIKGTDEYIIPIIGDGALTGGMALEALNHIGDEKKDMIVILNDNEMSIAPN
VGAIHSMLGRLRTAGKYQWVKDELEYLFKKIPAVGGKLAATAERVKDSLKYMLVSGMFFE
ELGFTYLGPVDGHSYHELIENLQYAKKTKGPVLLHVITKKGKGYKPAETDTIGTWHGTGP
YKINTGDFVKPKAAAPSWSGLVSGTVQRMAREDGRIVAITPAMPVGSKLEGFAKEFPDRM
FDVGIAEQHAATMAAAMAMQGMKPFLAIYSTFLQRAYDQVVHDICRQNANVFIGIDRAGL
VGADGETHQGVFDIAFMRHIPNMVLMMPKDENEGQHMVHTALSYDEGPIAMRFPRGNGLG
VKMDEQLKTIPIGTWEVLRPGNDAVILTFGTTIEMAIEAAEELQKEGLSVRVVNARFIKP
IDEKMMKSILKEGLPILTIEEAVLEGGFGSSILEFAHDQGEYHTPIDRMGIPDRFIEHGS
VTALLEEIGLTKQQVANRIRLLMPPKTHKGIGS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
ttggatcttttatcaatacaggacccgtcgtttttaaaaaacatgtccattgatgaatta
gagaaattaagtgatgaaatccgtcagtttttaattacaagtttatccgcttccggcggc
cacatcggcccaaacttaggtgtcgtagagcttactgttgccctgcataaggaatttaac
agcccgaaagacaaatttttatgggatgtaggccatcagtcgtatgtccataagctgctg
acaggacgcggaaaagaatttgcgacgcttcgccagtacaaagggctttgcggatttcca
aagcggagtgaaagcgagcacgatgtttgggaaaccgggcacagctcgacttctctgtca
ggcgcgatgggaatggcagctgcccgtgatattaaaggaacggatgaatatattattccg
atcattggtgacggcgcgctgaccggcggtatggcgctcgaagcccttaaccacatcggc
gacgagaaaaaagacatgattgtcatccttaatgataatgaaatgagtattgcgccaaac
gtcggtgccattcactctatgctcggacggctccgcactgcggggaaataccagtgggtc
aaagatgagcttgaatacttatttaaaaagattccggcagttgggggcaagcttgccgcc
acggcggaacgggtcaaagacagcctgaaatacatgctcgtctccggaatgtttttcgag
gagctcggttttacgtatttgggcccagtggacggacattcttatcatgagctgattgag
aatcttcaatacgccaaaaaaacgaaaggccctgttcttctgcacgtcattacgaaaaaa
gggaaggggtacaaaccggctgagaccgatacgattgggacatggcatggtaccggacca
tataaaattaataccggtgactttgtaaagccgaaagccgcagctccttcgtggagcggt
cttgtcagcggaactgtgcagcgaatggcgcgcgaggacggacgcattgtagccattacg
ccggctatgcctgtcggttcaaagcttgaaggcttcgcaaaggaattccctgaccggatg
ttcgacgtaggaatcgcagaacagcatgccgcaacaatggctgcagctatggcaatgcag
ggtatgaagccgtttttggcgatttactcaaccttcctgcaaagggcatatgaccaagtt
gttcatgacatctgccgccaaaacgctaatgtgtttattggaattgaccgtgctggactc
gttggcgctgatggagagacacatcaaggcgtgtttgatattgcgtttatgcgccacatt
ccaaacatggtcttaatgatgccgaaagacgaaaatgaaggccagcacatggttcataca
gcacttagctatgacgaaggcccgatagcaatgcgttttccgcgcggaaacggactcggc
gtaaaaatggatgaacagttgaaaacgattccgatcggtacgtgggaggtgctgcgtcca
gggaacgatgctgtcatcttaacattcggcacaacaatcgaaatggcgattgaagcagcc
gaagagctgcagaaagaaggcctttccgtgcgcgttgtgaatgcgcgttttattaagccg
attgatgaaaagatgatgaagagtatcctaaaagaaggcttgccaattttaacaattgaa
gaagcggtcttagaaggcggtttcggaagctcgattttagaattcgctcatgatcaaggt
gaatatcatactccgattgacagaatgggtatacctgatcggtttattgaacacggaagt
gtaacagcgcttcttgaggaaattggactgacaaaacagcaggtggcaaatcgtattaga
ttactgatgccaccaaagacacacaaaggaattggatcatga

DBGET integrated database retrieval system