KEGG   Bacillus subtilis subsp. subtilis 168: BSU24280
Entry
BSU24280          CDS       T00010                                 

Symbol
ispA
Name
(RefSeq) farnesyl diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU24280 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsu01006]
    BSU24280 (ispA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BSU24280 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BSU24280 (ispA)
    2.5.1.29  geranylgeranyl diphosphate synthase
     BSU24280 (ispA)
Prenyltransferases [BR:bsu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BSU24280 (ispA)
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 938652
NCBI-ProteinID: NP_390308
Pasteur: BG11714
BSORF: BG11714
UniProt: P54383 A0A6M3ZH31
Position
complement(2525789..2526679)
AA seq 296 aa
MTNKLTSFLADRKKTIENQLSVYTEKLDMPDSLKKSMLYSLQAGGKRLRPLIVLAVLNAY
GKSEKDGIPVGCAVEMIHTYSLIHDDLPCMDDDDLRRGKPTNHKVFGEATAVLAGDGLLT
ESFKLITSHVSDEVSAEKRLRLVNELISAAGTEGMVGGQVADMEAENRQVTLEELESIHE
RKTAKLLGFCVIAGAILADAPEEDIETLRTFSSHIGIGFQIRDDILDLEGSEEKIGKRVG
SDTTNDKSTYPSLLSLEGAKHKLDVHIKEAKRLIGGLSLQKDLLYELCDLIAARDH
NT seq 891 nt   +upstreamnt  +downstreamnt
gtgacaaataaattaacgagctttctggcggaccggaaaaaaacaattgaaaatcagctt
tctgtctatacagaaaagcttgatatgccggactcattaaagaaatctatgctatattct
ctacaggccggcggaaagcggttgcggcctctgattgtactggctgttttaaatgcatat
ggaaaaagcgaaaaagacggcattccggtgggctgtgctgtcgaaatgattcacacgtat
tcgttaattcatgatgatcttccatgcatggatgatgacgatttgcgccgcgggaagccg
acaaaccataaagtgtttggtgaagcgacggcagtattagcgggtgacgggctgctcaca
gaaagctttaagctgattacctcccacgtgtcagacgaggtgtcagcagaaaagcgcctg
cggcttgtgaatgaactgatttcagcggcaggcaccgaaggcatggtcggtgggcaagta
gctgatatggaagcggaaaaccgacaagtcacgcttgaagagctcgaatccattcatgaa
cggaaaactgccaagctccttggcttttgtgtaatcgccggtgctattttggctgatgcg
cctgaggaagacattgaaacactgcgtaccttcagcagccacattggaatcggatttcaa
atcagagacgatattttagatttagaaggcagtgaagagaaaatcggcaaacgtgtcggc
tcggataccacaaatgacaaatcgacatacccgtcgcttctttcattggaaggggccaaa
cataaattggatgttcatataaaagaggcgaagcgattgatcggcggactctctcttcaa
aaagaccttttatatgagctttgtgatttaattgcggcaagagatcactaa

DBGET integrated database retrieval system