KEGG   Bacillus subtilis subsp. subtilis 168: BSU24310
Entry
BSU24310          CDS       T00010                                 

Gene name
folD
Definition
(RefSeq) bifunctional protein FolD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00670  One carbon pool by folate
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSU24310 (folD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     BSU24310 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     BSU24310 (folD)
SSDB
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C
Other DBs
NCBI-GeneID: 938602
NCBI-ProteinID: NP_390311
Pasteur: BG11711
BSORF: BG11711
UniProt: P54382 A0A6M4JNE7
Position
complement(2528404..2529255)
AA seq 283 aa
MTATIIDGKETAREKREQLAKEVEELKKQGVTPGLAVILIGDDPASHSYVRGKKKAAETM
GMNFKLDQFDSSLTEAELLSIIDQYNQDPEFHGILVQLPLPDHISEKAVIERISPDKDVD
GFHPLNVGKMLLGEDTFLPCTPHGIVELLKKTNIDLSGKEVVVVGRSNIVGKPVGQLLLN
ENATVTYCHSRTENITEHTKKADILVVAVGRANFISADQIKEGAVVIDVGVNRLENGKLC
GDVEFEGAKEKASFITPVPGGVGPMTITMLAHNTVKSAKRTLS
NT seq 852 nt   +upstreamnt  +downstreamnt
atgactgcaacaatcatcgacggaaaagaaacggctagagaaaaacgcgaacaattggca
aaagaggtagaagagcttaaaaagcaaggcgtcactcccggactggcggttattttgatt
ggagatgatcctgcttctcactcttacgtgcgaggaaagaaaaaagcggcagaaacaatg
ggaatgaatttcaagctcgatcaatttgacagcagcctcacagaagctgaactgctttcc
attattgatcaatataaccaagaccctgagtttcatggcattctcgttcagcttccgctc
ccagaccatatttctgaaaaagcggtgatcgaacgtatctcccctgataaagatgtagac
ggttttcatccgttaaacgtagggaaaatgctgcttggcgaagatacgtttcttccttgc
acgcctcatggaattgttgagcttttgaagaaaaccaatattgacctttccggtaaagag
gttgttgtagtcggccgaagcaacattgtcggcaaacctgtcggccagcttttattaaat
gaaaacgcgacggttacttactgtcattcaagaacagaaaatattactgaacatacgaaa
aaagcggacatcctggtggtggcagtcggcagagccaacttcatcagtgcagaccagatc
aaagagggcgctgttgtcattgacgtcggcgttaaccgtctggaaaacggaaagctttgc
ggagacgttgaatttgaaggggcaaaggaaaaagcgtccttcataacgccggttccgggc
ggagtaggtccgatgaccatcacgatgcttgcgcataatactgttaaatctgcgaaacgt
acgttatcatag

DBGET integrated database retrieval system