KEGG   Bacillus subtilis subsp. subtilis 168: BSU24320
Entry
BSU24320          CDS       T00010                                 

Symbol
nusB
Name
(RefSeq) N utilization substance protein B
  KO
K03625  transcription antitermination protein NusB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU24320 (nusB)
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU24320 (nusB)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU24320 (nusB)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA transcription factors
   BSU24320 (nusB)
SSDB
Motif
Pfam: NusB Phage_term_smal
Other DBs
NCBI-GeneID: 938606
NCBI-ProteinID: NP_390312
Pasteur: BG11710
BSORF: BG11710
UniProt: P54520 A0A6M4JJ19
Position
complement(2529267..2529662)
AA seq 131 aa
MKRRTAREKALQALFQIDVSDIAVNEAIEHALDEEKTDPFFEQLVHGVLEHQDQLDEMIS
KHLVNWKLDRIANVDRAILRLAAYEMAYAEDIPVNVSMNEAIELAKRFGDDKATKFVNGV
LSNIKSDIEQS
NT seq 396 nt   +upstreamnt  +downstreamnt
atgaaaagaagaacagcaagagaaaaagctttgcaggcactatttcaaattgatgtcagc
gatattgcagtgaatgaagccatagaacacgcactggatgaagaaaaaacagatcctttc
tttgaacagcttgtacacggggtattggaacaccaagaccagctggatgaaatgatctcc
aagcatctggtgaattggaagctcgatcggattgccaatgttgaccgtgcgattttgcgc
ctggcagcatatgaaatggcatatgccgaagacattccggtgaatgtctccatgaacgaa
gcgattgagctggcaaaacggtttggtgatgacaaagcgacaaagtttgtaaacggggtt
ctttctaacattaaatctgatattgaacaatcatag

DBGET integrated database retrieval system