KEGG   Bacillus subtilis subsp. subtilis 168: BSU24330
Entry
BSU24330          CDS       T00010                                 

Symbol
yqhY
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Asp23
Other DBs
NCBI-GeneID: 938598
NCBI-ProteinID: NP_390313
Pasteur: BG11709
BSORF: BG11709
UniProt: P54519 A0A6M4JIZ8
Position
complement(2529926..2530333)
AA seq 135 aa
MKDNSLLKMDHEDTHLGKVEIAPEVIEVIAGIAASEVDGVAEMRGNFATGVVERFGKVNH
GKGVKVDLADDGITIDVYCVVTFGVSIPKVAASVQENIRQTLLNMTSLSINEINIHIVGI
QFDTKAQEVQIDEEM
NT seq 408 nt   +upstreamnt  +downstreamnt
atgaaagacaacagcttgcttaaaatggatcacgaagatacgcatttgggtaaggttgag
attgcaccggaggtcattgaggtcattgccggcattgcagcatcagaagttgatggagtt
gccgaaatgcgcggaaactttgcgacaggcgtcgttgagcgctttggcaaagtgaatcat
ggcaaaggtgtcaaagtcgacctggcggatgacggaattacgatcgatgtatactgtgtc
gttacatttggcgtttcgattccgaaagttgcagcatccgttcaggaaaacattcgtcaa
accttattaaatatgacgtctctttcgattaacgagatcaatattcacatcgtcggcatt
caatttgacacaaaagcccaagaagtccaaatcgacgaagaaatgtaa

DBGET integrated database retrieval system