KEGG   Bacillus subtilis subsp. subtilis 168: BSU24340
Entry
BSU24340          CDS       T00010                                 

Symbol
accC
Name
(RefSeq) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00620  Pyruvate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01212  Fatty acid metabolism
Module
bsu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU24340 (accC)
   00640 Propanoate metabolism
    BSU24340 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU24340 (accC)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BSU24340 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BSU24340 (accC)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK GARS_A ATP-grasp_3 ATP-grasp_5 Oxidored_nitro ATPgrasp_Ter LAL_C2 ATPgrasp_ST
Other DBs
NCBI-GeneID: 938588
NCBI-ProteinID: NP_390314
Pasteur: BG11384
BSORF: BG11384
UniProt: P49787 A0A6M3ZE38
Position
complement(2530354..2531706)
AA seq 450 aa
MIKKLLIANRGEIAVRIIRACRELGIETVAVYSEADKDALHVQMADEAFCIGPKASKDSY
LNVTNIVSVAKLTGTDAIHPGYGFLAENADFAELCEEVNVTFVGPSADAISKMGTKDVAR
ETMKQAGVPIVPGSQGIIENVEEAVSLANEIGYPVIIKATAGGGGKGIRVARTEEELING
IKITQQEAATAFGNPGVYIEKYIEDFRHVEIQVLADNYGNTIHLGERDCSIQRRLQKLLE
ESPSPALDSEIREQMGDAAVKAAKAVGYTGAGTVEFIYDYNEQRYYFMEMNTRIQVEHPV
TEMVTGTDLIKEQIKVASGMELSLKQEDVEFEGWAIECRINAENPSKNFMPSPGEIKMYL
PPGGLGVRVDSAAYPGYSIPPYYDSMIAKVITYGKTRDEAIARMKRALSEFVIEGIETTI
PFHLKLLEHETFVSGEFNTKFLETYDVMGS
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgattaaaaagctattgatcgccaacagaggagaaattgctgtcagaatcatcagagcc
tgcagagagctcggaattgagactgtcgctgtttattcagaagctgataaagatgccctt
catgttcaaatggccgatgaagctttttgtatcggaccgaaagcatcaaaagacagctat
ttaaacgttacaaatattgtgagtgttgcaaagctgactggcacggacgccattcatccg
ggatacggatttttagctgaaaatgctgatttcgctgaattatgtgaagaagtgaatgtc
acgtttgtcggcccgagcgctgacgccatttcaaaaatgggaacaaaagacgttgcgcgg
gaaacgatgaaacaggccggcgtgccaatcgtaccgggttcacagggaattatagaaaat
gtggaagaagcggtttcgcttgctaatgaaattgggtatcctgtaattataaaagccacc
gcaggcggaggcggaaaaggaattagggttgcccgcactgaagaggaactgattaatggc
attaagattacacagcaggaagcggcaactgcatttgggaatccaggtgtatacatcgaa
aaatacatagaagattttcgccacgttgagatccaagtgcttgctgataactacggaaat
acgatccatttgggcgaacgcgactgctcgatccaaagacgcctgcaaaagcttttggaa
gaatcaccatctcctgcccttgattcagaaatcagggagcaaatgggagatgcagcggta
aaggctgccaaagcggttggctatacaggtgctggaacagttgaatttatctatgactac
aatgaacagcgctattacttcatggaaatgaacacgagaatccaggtggagcacccagtc
acagaaatggtgacgggaactgacctgatcaaggaacaaatcaaagtggcttcaggaatg
gaactgagcctcaagcaagaagatgttgaatttgaaggctgggccatcgaatgccgaatc
aacgcagaaaacccaagcaaaaatttcatgccgtcacctggtgaaattaaaatgtacctg
cctcctggcggtcttggtgtccgtgtcgattcagctgcgtaccctggctattccatccca
ccgtactatgacagcatgattgcaaaggtaatcacatacggaaaaacgagagatgaagcg
attgcccgcatgaagcgcgcattgagcgaattcgtcatcgaaggcattgagacaacaatc
cctttccatttaaaactgcttgaacacgaaacatttgtgagcggagagtttaatacgaaa
tttttagaaacatatgatgtaatgggctcataa

DBGET integrated database retrieval system