KEGG   Bacillus subtilis subsp. subtilis 168: BSU24350Help
Entry
BSU24350          CDS       T00010                                 

Gene name
accB
Definition
(RefSeq) acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00620  Pyruvate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
bsu01212  Fatty acid metabolism
Module
bsu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU24350 (accB)
   00640 Propanoate metabolism
    BSU24350 (accB)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU24350 (accB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3 Tegument_dsDNA
Motif
Other DBs
NCBI-GeneID: 938587
NCBI-ProteinID: NP_390315
Pasteur: BG11383
BSORF: BG11383
UniProt: P49786
Position
complement(2531718..2532197)
Genome map
AA seq 159 aa AA seqDB search
MLNIKEIHELIKAIDESTIDEFVYENEGVSLKLKKHEAGTVQVMQQAPAAPVQAQAPQAV
QPQAQQAAAPAQEAPKQDENLHKITSPMVGTFYASSSPEAGPYVTAGSKVNENTVVCIVE
AMKLFNEIEAEVKGEIVEVLVENGQLVEYGQPLFLVKAE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatatcaaagaaatccacgagctgattaaagcaattgacgagtctacaattgac
gaattcgtatatgaaaatgaaggtgtatccttaaaactgaaaaaacacgaagcaggcacg
gttcaagtcatgcagcaggcaccggcagcacctgtacaagcacaggctccgcaggcagtt
cagccgcaagcgcagcaagcagcggcacctgcccaagaagcaccaaagcaagatgagaat
ctgcataaaatcacttcaccaatggtaggaacattttatgcttcttcatcaccggaagct
ggcccgtatgtaacagccggttcaaaagtaaatgaaaacacagttgtctgcattgtagaa
gcgatgaagcttttcaacgaaatcgaagcagaagtgaaaggcgaaatcgttgaagtatta
gtagaaaacggccagctggtcgaatacggacaacctctatttcttgtaaaagcggagtaa

DBGET integrated database retrieval system