KEGG   Bacillus subtilis subsp. subtilis 168: BSU24360
Entry
BSU24360          CDS       T00010                                 

Gene name
spoIIIAH
Definition
(RefSeq) stage III sporulation protein AH
  KO
K06397  stage III sporulation protein AH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU24360 (spoIIIAH)
SSDB
Motif
Pfam: SpoIIIAH DUF2140
Other DBs
NCBI-GeneID: 938600
NCBI-ProteinID: NP_390316
Pasteur: BG11415
BSORF: BG11415
UniProt: P49785 A0A6M4JL99
Structure
PDB: 
3TUF 3UZ0

Position
complement(2532353..2533009)
AA seq 218 aa
MLKKQTVWLLTMLSLVVVLSVYYIMSPESKNAVQMQSEKSASDSGEVATEKAPAKQDTKE
KSGTETEKGKEDGTKGTKDSSADKETSAEASEKGTVVTETADDDLFTTYRLDLEDARSKE
REELNAIVSSDDATAKEKSEAYDKMTALSEVEGTEKQLETLIKTQGYEDALVNAEGDKIN
ITVKSDKHSKSKATAIIDLVAKEIKTMKDVAVTFEPSK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcttaaaaaacaaaccgtttggctattaacaatgctcagtcttgtcgtggtgttaagc
gtctactatatcatgtcgccggaaagcaaaaacgccgtgcagatgcaaagtgaaaaaagc
gcgtctgacagcggagaggtcgcaactgaaaaagcgcctgccaagcaagacacgaaggaa
aaaagcggtacagaaactgaaaaaggaaaagaagatggaacaaagggaacgaaagattca
tcagcagacaaggaaacatccgctgaagccagtgaaaaaggaactgttgttacggaaaca
gccgatgatgatttgtttacaacgtaccgtcttgatttagaagatgccagaagcaaagaa
agagaagagctgaatgccattgtgtcaagcgatgatgcaacagccaaggagaaaagcgaa
gcatacgataaaatgacggctctcagtgaagtggaaggaacagaaaaacagctggaaacg
ctgattaaaacacaaggttacgaggatgcgcttgttaatgctgaaggagataaaatcaat
attacagtcaaatcagacaaacactctaaatcgaaggcgacagccattatagaccttgtg
gcaaaagaaatcaaaacaatgaaagatgtcgctgtcacatttgaaccctctaaataa

DBGET integrated database retrieval system