KEGG   Bacillus subtilis subsp. subtilis 168: BSU24360Help
Entry
BSU24360          CDS       T00010                                 

Gene name
spoIIIAH
Definition
(RefSeq) stage III sporulation protein AH
  KO
K06397  stage III sporulation protein AH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU24360 (spoIIIAH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIIAH CLN3
Motif
Other DBs
NCBI-GeneID: 938600
NCBI-ProteinID: NP_390316
Pasteur: BG11415
BSORF: BG11415
UniProt: P49785
Structure
PDB: 

Position
complement(2532353..2533009)
Genome map
AA seq 218 aa AA seqDB search
MLKKQTVWLLTMLSLVVVLSVYYIMSPESKNAVQMQSEKSASDSGEVATEKAPAKQDTKE
KSGTETEKGKEDGTKGTKDSSADKETSAEASEKGTVVTETADDDLFTTYRLDLEDARSKE
REELNAIVSSDDATAKEKSEAYDKMTALSEVEGTEKQLETLIKTQGYEDALVNAEGDKIN
ITVKSDKHSKSKATAIIDLVAKEIKTMKDVAVTFEPSK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaaaacaaaccgtttggctattaacaatgctcagtcttgtcgtggtgttaagc
gtctactatatcatgtcgccggaaagcaaaaacgccgtgcagatgcaaagtgaaaaaagc
gcgtctgacagcggagaggtcgcaactgaaaaagcgcctgccaagcaagacacgaaggaa
aaaagcggtacagaaactgaaaaaggaaaagaagatggaacaaagggaacgaaagattca
tcagcagacaaggaaacatccgctgaagccagtgaaaaaggaactgttgttacggaaaca
gccgatgatgatttgtttacaacgtaccgtcttgatttagaagatgccagaagcaaagaa
agagaagagctgaatgccattgtgtcaagcgatgatgcaacagccaaggagaaaagcgaa
gcatacgataaaatgacggctctcagtgaagtggaaggaacagaaaaacagctggaaacg
ctgattaaaacacaaggttacgaggatgcgcttgttaatgctgaaggagataaaatcaat
attacagtcaaatcagacaaacactctaaatcgaaggcgacagccattatagaccttgtg
gcaaaagaaatcaaaacaatgaaagatgtcgctgtcacatttgaaccctctaaataa

DBGET integrated database retrieval system