KEGG   Bacillus subtilis subsp. subtilis 168: BSU24370
Entry
BSU24370          CDS       T00010                                 

Symbol
spoIIIAG
Name
(RefSeq) stage III sporulation protein AG
  KO
K06396  stage III sporulation protein AG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU24370 (spoIIIAG)
SSDB
Motif
Pfam: DUF2157 DUF4834
Other DBs
NCBI-GeneID: 938595
NCBI-ProteinID: NP_390317
Pasteur: BG11414
BSORF: BG11414
UniProt: P49784 A0A6M3ZDR8
Position
complement(2533010..2533699)
AA seq 229 aa
MNKNGLWNVLKKQFLPGQTKDGEKPKLTKYHYFLFVFVLGVSFMLVSQLFSSPEKTENAK
TITAVSSQHSADSKEKTAEVFKASKSDKPKDSIDDYEKEYENQLKEILETIIGVDDVSVV
VNVDATSLKVYEKNKSNKNTTTEETDKEGGKRSVTDQSSEEEIVMIKNGDKETPVVVQTK
KPDIRGVLVVAQGVDNVQIKQTIIEAVTRVLDVPSHRVAVAPKKIKEDS
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaataaaaacggattatggaatgtattgaaaaagcagtttcttccgggacaaacgaag
gacggcgaaaagccgaagctgaccaaatatcattactttctattcgtttttgttctcgga
gtttcctttatgcttgtcagccagctgttttcttcacctgagaaaactgaaaacgccaaa
acgataacggccgtatcatcacaacattccgcagacagcaaagagaaaacagccgaagtg
tttaaagcctcaaaatctgataaacctaaagactcgatcgatgactatgaaaaagaatac
gaaaatcaactgaaagaaattcttgaaacaatcattggtgtggacgatgtctcggttgtc
gtgaatgtagatgcaacgtcgctgaaagtatacgaaaaaaacaaatcaaacaaaaataca
accactgaagaaactgacaaagaaggcggaaaaagaagcgttacagaccaatcatcggag
gaagaaatcgtcatgatcaaaaacggcgataaagaaacacctgtcgtcgtccaaacgaaa
aaacctgatatacgcggtgtactcgttgttgctcaaggagtggacaacgttcaaataaaa
caaaccattatcgaagcggtgacacgggtcctggatgttccaagccaccgggttgcggtt
gcccctaaaaaaataaaggaggattcataa

DBGET integrated database retrieval system