KEGG   Bacillus subtilis subsp. subtilis 168: BSU24380
Entry
BSU24380          CDS       T00010                                 

Symbol
spoIIIAF
Name
(RefSeq) stage III sporulation protein AF
  KO
K06395  stage III sporulation protein AF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU24380 (spoIIIAF)
SSDB
Motif
Pfam: Spore_III_AF PAP2_3 DUF3043
Other DBs
NCBI-GeneID: 938576
NCBI-ProteinID: NP_390318
Pasteur: BG11413
BSORF: BG11413
UniProt: P49783 A0A6M4JMB5
Structure
Position
complement(2533692..2534312)
AA seq 206 aa
MSFLTEWLTTIVLFILFAIVIDMLLPSSSMQKYAKMVVSLLLIVVMLTPIFKLFKTDPEV
IFEYLTKNGQSESADIKNQINSKKIEIQASQRAYILEEMAVQLKKKAEERFSHDEYKVGR
IKLTAGEKVDSEEDIKTISVYMAPSSEKTVQTVAPVHIDTDHAYVTKEAAEQKEAKQIQT
QLADIWEIGSEKITVHMEGGESVGNE
NT seq 621 nt   +upstreamnt  +downstreamnt
atgagttttttaacggaatggcttaccaccatcgtgttgtttatcctatttgcaattgtg
attgatatgctgctgccgagctccagcatgcaaaagtacgcaaaaatggtagtcagcctg
ctcttgattgtcgtcatgcttacgccgatttttaaacttttcaagacagaccccgaagtc
atctttgaatacctcacaaaaaacgggcagtcagagtctgccgacataaaaaatcaaatc
aattcaaaaaaaatagaaatacaagcttcccagcgcgcatatattctagaagaaatggct
gtccaactaaaaaagaaagcggaggagagattcagtcatgatgaatataaagtaggccgc
atcaaactcacggcaggagaaaaggtagattcagaagaggatattaaaacaatcagcgtg
tatatggccccgtcttctgaaaaaacggtccaaacggtcgcgccggtccacattgataca
gatcatgcatacgtaacaaaagaagcagccgaacaaaaagaagccaaacagatacaaacg
cagctcgcggacatttgggaaatcggaagtgagaaaattacggttcatatggaaggcggg
gagagtgtcggcaatgaataa

DBGET integrated database retrieval system