KEGG   Bacillus subtilis subsp. subtilis 168: BSU24390
Entry
BSU24390          CDS       T00010                                 

Symbol
spoIIIAE
Name
(RefSeq) stage III sporulation protein AE
  KO
K06394  stage III sporulation protein AE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU24390 (spoIIIAE)
SSDB
Motif
Pfam: Spore_III_AE GCS2
Other DBs
NCBI-GeneID: 938569
NCBI-ProteinID: NP_390319
Pasteur: BG11412
BSORF: BG11412
UniProt: P49782 A0A6M3ZDY2
Position
complement(2534326..2535525)
AA seq 399 aa
MKRFQWVLLLAVLIIAGRAEIVQAAGNAEQTEDHAETAEQLAERTAASLETDKIGEFWND
IMTEYGGLLPESQKGSLMEFINGDKSFSPQEWLKALFSYLFHEVLANGKLLGTLILLTIF
CVILQLLQNAFQQSTVSKVAYSIVYMVLIILALNSFHVAINYATEAIQTMTSFILALIPL
LLALLASSGGAVSAAFFHPVILFLMNTSGLLIQNIVMPLIFLSAILSIVSTMTEQYKVTQ
LANLLRNIAIGALAVFLTIFLGVISVQGASAAVTDGITLRTAKFITGNFIPVLGRMFTDA
TDTVISASLLLKNTVGILGVAILICIAAFPAIKVLSLAFIYKLAAAILQPLGGGPVITCL
DVISKSVIYIFAALAIVSLMFFLSLTVIITAGNLTMMMK
NT seq 1200 nt   +upstreamnt  +downstreamnt
ttgaagcgctttcaatgggttttgcttttggccgtgctgatcatagcaggccgtgcagaa
attgtacaagcagctggtaatgcagaacaaacggaagaccatgctgaaacagccgagcaa
ttagcggaaaggacagcagcctcgcttgaaacagataagatcggggaattttggaatgac
attatgacagaatacggcggactgctgccggaaagccaaaaaggcagcttaatggagttt
atcaatggcgataaatcattctcaccgcaagaatggctgaaagctctcttttcttatttg
tttcatgaagtgcttgccaacggaaagctgctgggcacattgattttgctcacgattttt
tgcgtcattctgcagcttttgcaaaatgcttttcagcaaagcaccgtcagtaaggtcgct
tactcaattgtgtacatggtgctgattatccttgcgcttaatagctttcatgtggcaatt
aactatgcaactgaggcgattcagacgatgaccagctttatcctggcgctcattccgctc
ctcttggcgcttttggcttcctcaggcggagctgtatctgctgccttctttcatcctgtt
atcctcttcctgatgaacacgagcggtctcttgattcagaatatcgtcatgccgctgatt
tttttatcagcgattctgagcattgtcagcacgatgactgaacaatacaaagtaacgcag
ctggctaacctgctcagaaatatcgccatcggagcactggctgtttttcttaccatcttt
ctcggcgtcatctctgttcagggagcgtcagctgcagtgacagacggcattacgctcagg
acggctaaatttataaccggaaattttattcctgtgcttggccgaatgtttacagacgca
acagatacagtaatcagcgcctctttactgctgaaaaatacggtagggattctcggtgtc
gctattttgatctgtattgcggcatttccggcaatcaaagtgctttccctcgcttttatt
tataagctggcagccgcgattcttcagccgctaggaggcgggcccgtcatcacctgcctc
gacgtcatcagcaaaagcgtcatttatatttttgcagctctcgccattgtgtctctcatg
ttttttttaagccttactgtcataatcacagccggaaacctcacgatgatgatgaaatga

DBGET integrated database retrieval system