KEGG   Bacillus subtilis subsp. subtilis 168: BSU24400
Entry
BSU24400          CDS       T00010                                 

Symbol
spoIIIAD
Name
(RefSeq) stage III sporulation protein AD
  KO
K06393  stage III sporulation protein AD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU24400 (spoIIIAD)
SSDB
Motif
Pfam: SpoIIIAC
Other DBs
NCBI-GeneID: 938577
NCBI-ProteinID: NP_390320
Pasteur: BG11411
BSORF: BG11411
UniProt: P49781 A0A6M4JNN5
Position
complement(2535544..2535945)
AA seq 133 aa
MQIDIVQIVGLGLIATFLSLIVKEQKPTFAFLIVVFAGCAIFLYLVDQIYDIIRMIEKIA
INANVNMVYVETILKIIGIAYIAEFGAQLTKDAGQGAIASKIELAGKILILVMAVPILTV
IIETILGLIPSMS
NT seq 402 nt   +upstreamnt  +downstreamnt
ttgcagattgacattgttcaaattgtaggtttagggctgatcgccaccttcctttcttta
attgtaaaagaacaaaagccgacttttgcgtttttaatcgtcgtttttgccggatgtgcc
atttttctttatttggtagaccaaatctacgacattattcgaatgatagaaaaaattgcg
attaatgcaaatgtcaacatggtctatgttgaaaccattttaaagattatcggaatcgcc
tatattgctgaattcggggcacagctcacaaaagatgccggtcaaggagccatcgcctcg
aaaatagaattggcggggaaaattttaatactcgtaatggctgtgcctattttaaccgtc
attatcgaaacgattctcggacttataccttctatgtcataa

DBGET integrated database retrieval system