KEGG   Bacillus subtilis subsp. subtilis 168: BSU24410
Entry
BSU24410          CDS       T00010                                 

Symbol
spoIIIAC
Name
(RefSeq) stage III sporulation protein AC
  KO
K06392  stage III sporulation protein AC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU24410 (spoIIIAC)
SSDB
Motif
Pfam: SpoIIIAC Yip1
Other DBs
NCBI-GeneID: 938562
NCBI-ProteinID: NP_390321
Pasteur: BG11410
BSORF: BG11410
UniProt: P49780 A0A6M3ZEB2
Position
complement(2535952..2536158)
AA seq 68 aa
MGVDVNVIFQIAGVGIVVAFLHTILDQMGKKEYAQWVTLLGFIYILFMVATIVDDLFKKI
KAVFLFQG
NT seq 207 nt   +upstreamnt  +downstreamnt
atgggagtagacgtgaatgtcatatttcaaatcgccggagtgggaatcgtggtcgctttt
ttacacacgatattggatcagatgggcaagaaagaatatgctcagtgggtgacgctgtta
ggttttatctatattttatttatggtcgccacgattgtagatgacctatttaaaaagata
aaagctgtgtttttattccaaggatag

DBGET integrated database retrieval system