KEGG   Bacillus subtilis subsp. subtilis 168: BSU24420Help
Entry
BSU24420          CDS       T00010                                 

Gene name
spoIIIAB
Definition
(RefSeq) stage III sporulation protein AB
  KO
K06391  stage III sporulation protein AB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU24420 (spoIIIAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_III_AB Caskin-tail Myco_haema ApoLp-III LapA_dom
Motif
Other DBs
NCBI-GeneID: 938561
NCBI-ProteinID: NP_390322
Pasteur: BG10541
BSORF: BG10541
UniProt: Q01368
Structure
PDB: 

Position
complement(2536181..2536696)
Genome map
AA seq 171 aa AA seqDB search
MLKLLGAVFIVVATTWTGFEMAKIYTERPRQIRQLRAALQSLEAEIMYGHTPLHTASQQI
AKQLAQPVSTLFSAFSDQLDKGSDSAKTAWEQSLKKVWDTLSLKKSEYEVLKQFGETLGI
HDRISQQKHIKLALTHLEASEADAEQAQAKNEKMIKSLGFLAGLLLILLLM
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagctgctgggcgctgtattcattgtggtagcgacaacatggacaggttttgag
atggcgaagatttatacagaacggccgcggcaaatccgccagctgcgtgcggcgcttcaa
tccctcgaggctgaaatcatgtacggccatacaccgcttcatactgcttcacagcagatt
gccaaacagctcgcacagcctgtttcaactcttttttccgcattcagtgatcagctggac
aagggaagtgattccgcgaaaacggcgtgggagcaaagcttaaagaaggtatgggacacc
ctgtctttgaaaaaaagcgaatacgaagtgctgaagcagtttggcgagacgcttgggatt
catgatcgaatctctcagcaaaagcacatcaagctggcgctgacacatttggaagcctca
gaagcggatgctgagcaggcgcaagcgaaaaacgaaaagatgataaaaagtttgggcttt
ttagcgggcttgttactcattcttctattgatgtaa

DBGET integrated database retrieval system