KEGG   Bacillus subtilis subsp. subtilis 168: BSU24420
Entry
BSU24420          CDS       T00010                                 

Gene name
spoIIIAB
Definition
(RefSeq) stage III sporulation protein AB
  KO
K06391  stage III sporulation protein AB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU24420 (spoIIIAB)
SSDB
Motif
Pfam: Spore_III_AB Myco_haema ApoLp-III LapA_dom
Other DBs
NCBI-GeneID: 938561
NCBI-ProteinID: NP_390322
Pasteur: BG10541
BSORF: BG10541
UniProt: Q01368 A0A6M4JJ29
Structure
PDB: 
6BS9

Position
complement(2536181..2536696)
AA seq 171 aa
MLKLLGAVFIVVATTWTGFEMAKIYTERPRQIRQLRAALQSLEAEIMYGHTPLHTASQQI
AKQLAQPVSTLFSAFSDQLDKGSDSAKTAWEQSLKKVWDTLSLKKSEYEVLKQFGETLGI
HDRISQQKHIKLALTHLEASEADAEQAQAKNEKMIKSLGFLAGLLLILLLM
NT seq 516 nt   +upstreamnt  +downstreamnt
atgctgaagctgctgggcgctgtattcattgtggtagcgacaacatggacaggttttgag
atggcgaagatttatacagaacggccgcggcaaatccgccagctgcgtgcggcgcttcaa
tccctcgaggctgaaatcatgtacggccatacaccgcttcatactgcttcacagcagatt
gccaaacagctcgcacagcctgtttcaactcttttttccgcattcagtgatcagctggac
aagggaagtgattccgcgaaaacggcgtgggagcaaagcttaaagaaggtatgggacacc
ctgtctttgaaaaaaagcgaatacgaagtgctgaagcagtttggcgagacgcttgggatt
catgatcgaatctctcagcaaaagcacatcaagctggcgctgacacatttggaagcctca
gaagcggatgctgagcaggcgcaagcgaaaaacgaaaagatgataaaaagtttgggcttt
ttagcgggcttgttactcattcttctattgatgtaa

DBGET integrated database retrieval system