KEGG   Bacillus subtilis subsp. subtilis 168: BSU24430
Entry
BSU24430          CDS       T00010                                 

Symbol
spoIIIAA
Name
(RefSeq) stage III sporulation protein AA
  KO
K06390  stage III sporulation protein AA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU24430 (spoIIIAA)
SSDB
Motif
Pfam: Spore_III_AA NTPase_1 TniB AAA_22 AAA T2SSE AAA_14 AAA_30 AAA_16 AAA_28 AAA_25 AAA_18 AAA_5 FtsK_SpoIIIE AAA_11 SRPRB
Other DBs
NCBI-GeneID: 938563
NCBI-ProteinID: NP_390323
Pasteur: BG10540
BSORF: BG10540
UniProt: Q01367 A0A6M4JJ02
Position
complement(2536690..2537613)
AA seq 307 aa
MNEIAEVLPESMKNALSEIPEQQWLEIEEVRIRINRPVELIRRGQPVYLSYAGTAEDAHL
ILSRLSNYSMYTLEEELKKGYVTIRGGHRVGLAGRVITENGGVKGLRDIASFNIRIARQK
LGIAEPLLPYLYQNSWLNTLIIGPPQTGKTTLLRDLARLSSTGKKNMLPVKTGIVDERSE
IAGCLRGIPQHQFGQRIDVLDACPKAEGLMMMIRSMSPEVMIVDEIGRMEDTDALLEALH
AGVSVIVSAHGWSISDLMKRPSLKRLWEERAFDRYLELSRAKGPGTVSQIYDKDGNVLSR
TTGVKTC
NT seq 924 nt   +upstreamnt  +downstreamnt
ttgaatgaaatcgctgaggttctccctgaatccatgaaaaacgccctttctgaaataccg
gaacaacaatggctggaaatcgaagaagtcagaattcggatcaaccgccctgttgaattg
attcgaagaggacaacctgtttatttgtcctatgcgggcacggccgaggatgcccatctg
atcctgagccggctcagcaactatagtatgtatacacttgaagaagagctgaagaaaggg
tatgtcacgatcagaggcggccacagagtcggactggcgggcagagtcattacggaaaac
ggaggtgtgaaaggcctccgtgacatcgcatcttttaatatacgaattgcccggcaaaag
ctggggattgcggagccgctgcttccatacttatatcaaaacagctggctgaatacgctg
attatcggaccgccccaaaccggcaaaacaacacttctccgggaccttgcgaggctctca
agcaccggcaaaaaaaacatgctgcccgtaaagacagggatcgtcgatgaacggtcagag
attgccggatgtcttcgcggtattccgcagcatcaatttggtcagagaattgacgtgtta
gacgcctgtccaaaagctgaagggctgatgatgatgattcgatccatgagccctgaggtg
atgattgtcgatgaaatcgggcgtatggaagatacagatgcacttctggaggcgctgcat
gccggtgtttcagtaatcgtatcggcgcatggctggagtatatccgacctgatgaagcgg
ccttcattgaagcgtttgtgggaagaaagagcctttgaccgctatttggaattatcaaga
gcaaaagggccgggcacagtgagccaaatttatgacaaagacggaaatgtgctgtctagg
acgacgggcgtgaaaacatgctga

DBGET integrated database retrieval system