KEGG   Bacillus subtilis subsp. subtilis 168: BSU24440
Entry
BSU24440          CDS       T00010                                 

Symbol
yqhV
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2619 DUF3852 DUF1435
Other DBs
NCBI-GeneID: 938559
NCBI-ProteinID: NP_390324
Pasteur: BG11459
BSORF: BG11459
UniProt: P49779 A0A6M3ZE47
Position
complement(2537689..2537970)
AA seq 93 aa
MKFLLGNINSTVLTMAGLRVLSSMIELTAAIVMLVTNDVRKAVVVNSILAIVGPLIFIIT
MTVGIYQIAGQLSYAKLILIFTGVVLILAGVHK
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaaatttttacttggaaatatcaattctactgttttaacaatggcgggattacgagtt
ttatcctctatgattgagctgacggcagcaattgtcatgcttgtgaccaacgatgtccgg
aaggcggttgtggttaacagcattctcgctattgtcggtccgttgatttttatcattaca
atgactgtcggaatctaccaaattgccgggcagctttcgtatgcaaagctgattctgatt
tttacgggtgttgtcttgattttggcgggtgttcataaataa

DBGET integrated database retrieval system