KEGG   Bacillus subtilis subsp. subtilis 168: BSU24450
Entry
BSU24450          CDS       T00010                                 

Symbol
efp
Name
(RefSeq) elongation factor P
  KO
K02356  elongation factor P
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsu03012]
    BSU24450 (efp)
Translation factors [BR:bsu03012]
 Prokaryotic type
  Elongation factors
   BSU24450 (efp)
SSDB
Motif
Pfam: EFP_N Elong-fact-P_C EFP
Other DBs
NCBI-GeneID: 938558
NCBI-ProteinID: NP_390325
Pasteur: BG11460
BSORF: BG11460
UniProt: P49778 A0A6M3ZDK4
Position
complement(2538115..2538672)
AA seq 185 aa
MISVNDFRTGLTIEVDGGIWRVVDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKV
AKAQIETKTMQYLYANGDQHVFMDTSSYEQLELSATQIEEELKYLLENMSVHIMMYQDET
LGIELPNTVELKVVETEPGIKGDTASGGTKPAKTETGLVVNVPFFVNEGDTLVVNTSDGS
YVSRA
NT seq 558 nt   +upstreamnt  +downstreamnt
atgatttcagttaacgatttccgtacaggattaacaattgaagtagatggcggcatttgg
cgcgtcgttgacttccagcacgtaaaacctggaaaaggtgcggcatttgtccgctctaaa
ctccgcaaccttcgcactggcgcgattcaggaaaaaacattccgcgctggtgaaaaagta
gcgaaagcgcaaatcgaaaccaaaacaatgcaatatctatatgcaaacggagatcagcac
gtatttatggatacttcttcttatgagcagcttgaactgagcgcaactcaaatcgaagaa
gaattaaaatacctgctagaaaacatgtctgtgcatatcatgatgtaccaggatgaaaca
cttggtatcgaacttccaaacacagttgagctgaaagttgttgaaactgaacctggtatt
aaaggtgatacagcgtcaggcggtacaaaacctgcgaaaactgaaaccgggcttgttgta
aacgtgccgttctttgtgaatgaaggcgacacacttgttgtcaatacatcagacggttct
tacgtttcaagagcatag

DBGET integrated database retrieval system