KEGG   Bacillus subtilis subsp. subtilis 168: BSU24460
Entry
BSU24460          CDS       T00010                                 

Symbol
yqhT
Name
(RefSeq) peptidase YqhT
  KO
K01262  Xaa-Pro aminopeptidase [EC:3.4.11.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU24460 (yqhT)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.9  Xaa-Pro aminopeptidase
     BSU24460 (yqhT)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M24
   BSU24460 (yqhT)
SSDB
Motif
Pfam: Peptidase_M24 Creatinase_N
Other DBs
NCBI-GeneID: 938560
NCBI-ProteinID: NP_390326
Pasteur: BG11708
BSORF: BG11708
UniProt: P54518 A0A6M3ZDL0
Position
complement(2538697..2539758)
AA seq 353 aa
MKLEKLRNLFGQLGIDGMLITSNTNVRYMTGFTGSAGLAVISGDKAAFITDFRYTEQAKV
QVKGFEIIEHGGSLIQTTADTVESFGIKRLGFEQNSMTYGTYASYSAVISDAELVPVAES
VEKLRLIKSSEEIKILEEAAKIADDAFRHILTFMKPGISEIAVANELEFYMRSQGADSSS
FDMIVASGLRSSLPHGVASDKLIESGDLVTLDFGAYYKGYCSDITRTVAVGQPSDQLKEI
YQVVFDAQALGVAHIKPGMTGKEADALTRDHIAAKGYGDYFGHSTGHGLGMEVHESPGLS
VRSSAILEPGMVVTVEPGIYIPETGGVRIEDDIVITENGNRTITHSPKELIIL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgaagctagagaaattaagaaacctgtttggacagctgggaattgacggcatgctgatt
acaagcaacactaatgtacgctatatgacagggtttacaggttcggcgggtttggctgtt
atatcgggtgacaaagcagcgtttattacggattttcgttatactgagcaggcgaaggtt
caggtaaagggttttgagatcattgaacatggcggcagcttgattcagaccactgccgac
actgttgaatcgtttggcatcaagcgtctcggctttgaacagaacagcatgacatatggc
acttacgcttcatacagcgccgttatcagtgatgccgaattagtgcctgtggctgaatcc
gtggaaaagttgcgcttgattaagtctagtgaagagattaagatattagaggaagctgcg
aagattgcagatgatgccttcagacatatcttgacgtttatgaaacccggcatttctgaa
atcgctgttgccaatgagctggagttttatatgagaagccagggagcagacagctcttct
tttgatatgattgtcgcctcaggccttcgttcaagccttccgcacggtgtggccagtgac
aaactgattgaaagcggagaccttgttacgcttgattttggcgcttattataaaggatat
tgttctgatattacccggacggtcgctgtaggtcagcccagtgatcaattgaaggagatc
tatcaggttgtatttgatgctcaggcgcttggcgtcgcacatattaagccgggaatgaca
ggaaaagaggctgacgccctcacaagggatcatattgctgcaaaaggctacggtgactat
ttcggccattcaaccgggcacgggctcggcatggaagttcatgaatcgccgggattatcc
gtcagatcttcagctatccttgaaccgggtatggtggtcacagtggagccgggcatttac
ataccagaaacaggcggtgtccgcattgaagatgacatcgtgattacagaaaacggcaac
cggacaatcacccattccccaaaagaacttattattttgtga

DBGET integrated database retrieval system