KEGG   Bacillus subtilis subsp. subtilis 168: BSU24470
Entry
BSU24470          CDS       T00010                                 

Symbol
yqhS
Name
(RefSeq) 3-dehydroquinate dehydratase
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU24470 (yqhS)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     BSU24470 (yqhS)
SSDB
Motif
Pfam: DHquinase_II PrpR_N
Other DBs
NCBI-GeneID: 938557
NCBI-ProteinID: NP_390327
Pasteur: BG11707
BSORF: BG11707
UniProt: P54517 A0A6M4JKN5
Structure
Position
complement(2539755..2540201)
AA seq 148 aa
MPHFLILNGPNVNRLGSREPEVFGRQTLTDIETDLFQFAEALHIQLTFFQSNHEGDLIDA
IHEAEEQYSGIVLNPGALSHYSYAIRDAVSSISLPVVEVHLSNLYAREEFRHQSVIAPVA
KGQIVGLGAEGYKLAVRYLLSQQGGESR
NT seq 447 nt   +upstreamnt  +downstreamnt
gtgcctcattttttgattttgaacggaccgaatgttaaccggcttgggagtcgtgagcct
gaagtattcggccgccagacactgaccgatattgaaacagatctttttcagtttgctgaa
gccttacatatccagctcactttcttccagtctaatcacgaaggtgatttgatagatgcg
atacatgaggctgaggagcaatacagcgggattgttctgaaccccggcgccctgagtcat
tacagctatgcgatcagggatgctgtttcaagcatcagtcttcctgtggtagaggtgcat
ttatcaaacttatacgccagggaagaattcaggcatcagtcggttatcgctcctgttgcg
aaagggcagattgtcggtcttggagctgaaggctacaagcttgctgttcgctacttatta
agccagcaagggggagaatcaagatga

DBGET integrated database retrieval system