KEGG   Bacillus subtilis subsp. subtilis 168: BSU24480
Entry
BSU24480          CDS       T00010                                 

Gene name
yqhR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YqhR DUF1440 PHO4
Other DBs
NCBI-GeneID: 938555
NCBI-ProteinID: NP_390328
Pasteur: BG11706
BSORF: BG11706
UniProt: P54516 A0A6M4JMB8
Position
complement(2540288..2540824)
AA seq 178 aa
MMTSEKDTEQNEELNEKQKPPVSMAGRVAATGFCGGVLWSFVAYIAYLFHFSEISPNMIL
QPFVLGEWKKHGLGTVISIILIGVISIGAAFLYFLLLKRLKTMWPGILYGLVLWLLVFFV
FNPIFPDVRTVTELTSDTIITTICIYLLYGLFVGYSISFEYNELNSEKLARALGMHRE
NT seq 537 nt   +upstreamnt  +downstreamnt
atgatgacaagcgaaaaagatacagaacaaaatgaagaattgaatgagaagcaaaagccg
cctgtttcaatggccggcagggtggcggcaacaggtttttgcggaggcgtactttggagt
ttcgttgcttatatcgcatatttgtttcatttttccgaaatcagcccgaatatgatattg
cagccgtttgtactcggagagtggaaaaaacatgggctgggaacggtaatcagcatcatt
ttgattggagtaatttcaattggcgcagcatttctttattttcttctattgaaacgttta
aaaacaatgtggccgggtattttatacggcttggtgctttggctgctcgtgttttttgtt
tttaatccgatttttccagatgtgcgcacggtgaccgaactgacatcagatacaattatt
acgaccatttgcatttatttgctttacgggctgtttgtcgggtattctatttcatttgaa
tacaatgagctgaattcggaaaagcttgcacgtgcgctgggaatgcatagagaatag

DBGET integrated database retrieval system