KEGG   Bacillus subtilis subsp. subtilis 168: BSU24490
Entry
BSU24490          CDS       T00010                                 

Symbol
yqhQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1385
Other DBs
NCBI-GeneID: 938556
NCBI-ProteinID: NP_390329
Pasteur: BG11705
BSORF: BG11705
UniProt: P54515 A0A6M4JJC9
Position
2541051..2542007
AA seq 318 aa
MSKHKVPPAYGGQAVVEGVMFGGKHHYVTAIRRTDGSIDFFKLPRKHNPKLNIVKKIPFL
RGIAAIIEASANGTKHLNFSSERYGLDPSEDETLEQEEKKSSGLSMYLSLAVIGVLSFLF
SKFVFTLVPVFLAELTRPIFSLNTAQIAIESLFKLILLLGYIYFLSMTPLIKRVFQYHGA
EHKVINCYEQNLPITVENVQNQSRLHYRCGSSFILFTIIVGMFVYLLVPTDPLWLRVIDR
VALIPVVLGISFEVLQLTNKVRDIPGLKLLGYPGLWLQLLTTKEPKDEQVEVAIESFNEL
LRLEALSEQNQKPSHNVI
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtcaaaacataaagttccgcccgcttacggcgggcaggctgttgtggaaggcgttatg
tttggcggaaagcatcattacgttacagccatcagaagaacggatggaagcattgacttt
tttaagcttccacgcaaacacaacccgaaactgaacatcgtgaaaaagataccgttttta
cgggggatcgcggccattatcgaagcgagtgcaaacggcacaaagcatttgaatttttca
agcgaacgttacgggctcgatccatctgaagacgagacacttgagcaggaagaaaaaaaa
tcctctgggctgtctatgtatctcagcctcgcagttataggcgtcctatcatttttgttc
agtaaattcgtatttacattggttccagttttcttagcggaactgacaaggccgattttt
tccttgaacacagcgcaaatcgcgattgaaagcctgtttaagttgattttgctgctcggt
tacatctattttttgtccatgacaccgcttattaaaagagtgtttcaatatcatggagcc
gaacataaagtcataaactgttatgaacagaatttgccaattactgtggagaatgtccaa
aaccaatctcggcttcattaccgctgcggatcaagctttattttatttacgattattgtc
ggcatgtttgtttatttactcgttccgacagatccgctttggctgcgtgttatagatcgt
gtcgcactgataccggtcgtgcttggtatatcctttgaagttctgcagctgacaaacaaa
gtgcgtgacattcccggtctgaaattacttgggtacccgggactttggcttcagctgtta
accacaaaggaacctaaggatgaacaggttgaagttgccatcgaaagctttaacgaactt
ctcagactcgaagcattgtctgagcaaaatcagaagccttctcacaacgtcatctaa

DBGET integrated database retrieval system