KEGG   Bacillus subtilis subsp. subtilis 168: BSU24500
Entry
BSU24500          CDS       T00010                                 

Symbol
yqhP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SARAF Wzy_C DUF975 SLATT_4 Myc_target_1 DUF2070 HemY_N Saf_2TM Choline_transpo Spore_YabQ Ac76
Other DBs
NCBI-GeneID: 938552
NCBI-ProteinID: NP_390330
Pasteur: BG11704
BSORF: BG11704
UniProt: P54514 A0A6M4JNN7
Position
2542047..2542442
AA seq 131 aa
MNHRVQPIIAVLIALGAFGFLYVLVTNPGEMAKMAVTVIVAGIIIYFIVKYVMNRNAGSE
GAAFKKAAKQSRRRMKEQKAKHRAGHKGRVSHLRSVPSASKPKPMILKKKSQTQLTVIEG
KKNKKKNRALF
NT seq 396 nt   +upstreamnt  +downstreamnt
atgaatcatcgtgtacaacctattattgctgtattaattgcgctgggagcgttcggtttc
ctctatgtgctggtaaccaatcccggagaaatggcaaaaatggcggtaaccgtcatcgtg
gcaggtatcattatttattttattgtgaaatatgtaatgaatcgaaatgcgggcagcgaa
ggagcagccttcaaaaaagcggcgaaacaatcacggcgccggatgaaagaacaaaaagca
aaacaccgcgccggacataagggacgtgtcagccacctgcgaagcgttccgagcgccagc
aagcctaagccgatgattctcaagaaaaaaagccagactcagctgactgttatagaaggg
aaaaaaaataaaaagaaaaacagagcgcttttttaa

DBGET integrated database retrieval system