KEGG   Bacillus subtilis subsp. subtilis 168: BSU24510
Entry
BSU24510          CDS       T00010                                 

Symbol
yqhO
Name
(RefSeq) hypothetical protein
  KO
K07001  NTE family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU24510 (yqhO)
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-GeneID: 938553
NCBI-ProteinID: NP_390331
Pasteur: BG11703
BSORF: BG11703
UniProt: P54513 A0A6M3ZEC3
Position
complement(2542439..2543314)
AA seq 291 aa
MYIDGVFSGGGVKGIALAGAYEVLEEKGFRFKRVAGTSAGAIIAAFIASGYTSKEIHALI
EEVDGEKLLDQRYSFLPLKMLQWVSIYWRLGLYKGDTIEKWIADLLRAKGIRVFGDLQKG
SLRLIASDLTNGTMIVLPDDLARYGLNPDMFPVARAVRMSCSIPYFFEPIKLKTDTGTAT
VVDGGVLSNFPIWLFSKERKRPVIGVTLAPRERERPKKNIRNAFELFGALFETMKDAHDA
RHIASRYEQNIIFLPVDDVMATDFHLTQQKKLALIELGKRRTELFLKQWTY
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtatattgacggtgtgttttccggcggaggagtaaaaggcattgcgctcgcaggcgct
tatgaagtgcttgaggaaaaaggcttccgctttaaaagagttgcgggtacaagcgccggc
gccattattgccgctttcattgcgtcaggttacaccagtaaggaaatccacgctttaatt
gaagaagtggacggagagaaattgctggatcagaggtactcatttctccccttaaagatg
ctccagtgggtgtccatctactggcgtcttggcttatacaaaggcgatacgatagaaaaa
tggattgctgatctgttaagagcgaaaggcataagggttttcggcgatttgcagaaaggg
tctctgcgccttattgcttctgatctgacaaacggcaccatgattgttttgccggacgat
ttggcccgttacgggttaaatccagatatgttcccggttgccagagcggtcagaatgagc
tgcagcattccgtatttctttgaaccgataaaattaaaaacggacacaggcaccgccacg
gttgtcgacggaggcgtgttaagcaattttccaatctggctgttttcaaaggaaagaaag
cgccctgtgatcggtgtcacgcttgcgccgcgtgaaagagagcgtccgaaaaaaaatatc
cgcaacgcttttgaactgttcggcgccctgtttgaaacgatgaaggatgctcatgacgca
aggcacattgcgtcacgctatgaacaaaatatcatttttctccctgttgatgacgtaatg
gccactgattttcatttaacacaacaaaaaaaactagccctgattgagctaggtaaaaga
cggacagagctgtttttaaagcagtggacctattaa

DBGET integrated database retrieval system