KEGG   Bacillus subtilis subsp. subtilis 168: BSU24520
Entry
BSU24520          CDS       T00010                                 

Gene name
mntR
Definition
(RefSeq) transcriptional regulator MntR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Fe_dep_repress Fe_dep_repr_C MarR MarR_2 TrmB HTH_IclR HTH_24 HTH_11 HTH_17 Rrf2 AbiEi_4 TetR_N OB_NTP_bind HTH_23 HTH_Crp_2 HTH_DeoR HTH_29 HTH_6
Other DBs
NCBI-GeneID: 938554
NCBI-ProteinID: NP_390332
Pasteur: BG11702
BSORF: BG11702
UniProt: P54512 A0A6M4JJ36
Structure
PDB: 

Position
complement(2543440..2543868)
AA seq 142 aa
MTTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGL
VLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYF
EEDDARKKDLKSIQKKTEHHNQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atgacaacaccaagtatggaagattatattgaacagatttatatgctgattgaagaaaaa
ggatatgcacgagtttccgatatcgcggaagcattggcagtccatccctcctctgtaaca
aaaatggttcaaaaactagataaagacgaatatttaatttatgaaaaatatcgcggtctc
gtgttaacgtctaaagggaaaaaaataggcaaacggctggtatacagacatgaattgctt
gagcagtttttaagaatcattggtgttgatgaagagaaaatatataacgatgtcgaagga
atcgaacatcatttaagctggaacagtattgatcgcatcggggatcttgttcaatatttt
gaagaagatgatgcccgtaaaaaagatctgaaatcaatccaaaagaaaacagaacatcat
aatcagtaa

DBGET integrated database retrieval system