KEGG   Bacillus subtilis subsp. subtilis 168: BSU24540
Entry
BSU24540          CDS       T00010                                 

Symbol
yqhL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Rhodanese DUF2393
Other DBs
NCBI-GeneID: 938550
NCBI-ProteinID: NP_390334
Pasteur: BG11700
BSORF: BG11700
UniProt: P54510 A0A6M4JKW2
Position
2544995..2545375
AA seq 126 aa
MSNMIVLIIFAAFIIYMIASYVYQQRIMKTLTEEEFRAGYRKAQLIDVREPNEFEGGHIL
GARNIPLSQLKQRKNEIRTDKPVYLYCQNSVRSGRAAQTLRKNGCTEIYNLKGGFKKWGG
KIKAKK
NT seq 381 nt   +upstreamnt  +downstreamnt
ttgtctaatatgatcgttttgattatttttgctgcatttatcatctatatgattgcttca
tatgtctatcagcagcgaattatgaaaacacttaccgaagaagaattccgcgcgggttac
cgcaaagcgcagcttattgatgttcgtgagccaaatgagtttgagggcggacatatttta
ggcgcccgcaacatcccgctttcccagctgaaacagagaaaaaatgagatccgtacggac
aagcctgtttacctgtactgccaaaacagtgtccgcagcggacgcgcggcacaaaccctg
cgcaaaaacggctgcactgagatttacaacctaaaaggcggctttaaaaaatggggcgga
aagattaaagcgaagaaataa

DBGET integrated database retrieval system