KEGG   Bacillus subtilis subsp. subtilis 168: BSU24550
Entry
BSU24550          CDS       T00010                                 

Symbol
gcvPB
Name
(RefSeq) glycine dehydrogenase subunit 2
  KO
K00283  glycine dehydrogenase subunit 2 [EC:1.4.4.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU24550 (gcvPB)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU24550 (gcvPB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     BSU24550 (gcvPB)
SSDB
Motif
Pfam: GDC-P Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Other DBs
NCBI-GeneID: 938549
NCBI-ProteinID: NP_390335
Pasteur: BG11511
BSORF: BG11511
UniProt: P54377 A0A6M4JLQ9
Position
complement(2545410..2546876)
AA seq 488 aa
MSNQDQALIFELSREGRIGYSLPELDVPEIELGDLLSDTYIRDEDAALPEVSELDIMRHY
TALSKRNHGVDSGFYPLGSCTMKYNPKINEKIARIPGFAAIHPLQDEDTVQGALELLYDL
SKHLEEITGMDEVTLQPAAGAHGEWTGLMMIRAYHEARGDFKRTKVIVPDSAHGTNPASA
TVAGFETVTVKSNEKGLVDLEDLKRAVNEETAALMLTNPNTLGLFEEQITEMAEIVHQAG
GKLYYDGANLNAVLSKARPGDMGFDVVHLNLHKTFTGPHGGGGPGSGPVGVKQDLIPYLP
KPVLVKKEGRFTFDYDRPHAIGRVKPYYGNFGINVRAYTYIRSMGPDGLKAVTENAVLNA
NYMMRKLAPYYDLPFDRHCKHEFVLSGKRQKKLGVRTLDIAKRLLDFGYHPPTIYFPLNV
EECIMIEPTETESKETLDAFIDAMIQIAKEAEENPELVQEAPHTTIVKRMDETKAARHPV
LRYEAEER
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgagtaatcaggaccaggcacttatttttgaactttcaagagaaggccgaatcggctat
agtctgccggagctcgatgtaccggaaatcgaattgggggacctcttgtcagacacctat
attcgtgacgaagacgcagcgctgccggaggtttcagagctggacatcatgcgccattat
acagcgctgtccaaacgcaatcacggggtggattccggtttttatcctctcggttcttgc
acgatgaaatataatccgaaaatcaatgaaaaaatcgcacgtattcctggttttgctgcg
attcatcctcttcaggatgaagacacggtgcaaggcgcattagagcttttatatgattta
agcaaacaccttgaagaaataacgggaatggatgaggttacgcttcagcctgctgccgga
gcgcacggcgaatggacggggctgatgatgatccgtgcctatcatgaagctcgcggggat
ttcaagcggacgaaggtcattgtccctgattccgcgcatgggacgaatcctgcatcagca
acagtagcaggctttgaaaccgttacggtgaaatcgaatgaaaaagggcttgttgattta
gaggatttaaaaagagcagtgaatgaagaaactgcagctcttatgctgacgaatccgaac
acgctcggcttgtttgaggagcagattacagagatggcggaaattgtacaccaagcgggg
gggaaactgtattatgacggcgctaatttaaatgccgttttaagcaaggcgagacctggt
gatatgggatttgacgtggtgcacctcaacctgcataaaacattcacaggccctcatggc
ggcggaggccccggctcaggccctgtcggcgtaaaacaagatctgattccttatttgcca
aagccagttttagtcaaaaaagaagggcgctttacgtttgattatgaccgccctcatgcg
atcggccgtgtgaagccgtattacggcaactttggcattaatgtgagagcgtatacgtat
attcgctccatggggcctgacggattaaaggctgttactgagaacgcagtgttaaacgcc
aattatatgatgagaaaactcgcgccttattacgatcttccgtttgaccgccattgcaag
catgaatttgtattatcagggaagcggcagaaaaagctgggagtgcgtacgcttgatatt
gcaaaacggctccttgatttcggctatcatccgccgacgatttatttcccgcttaatgtt
gaagaatgcatcatgatcgagccgacagagaccgaatcaaaggaaacactggacgcgttt
attgatgctatgattcaaatcgcaaaagaagcggaggagaatccggagcttgttcaggag
gccccgcatacaacgattgtaaaaagaatggatgaaacaaaagcggcgagacacccagtg
ctcagatacgaggcggaagaaagataa

DBGET integrated database retrieval system