KEGG   Bacillus subtilis subsp. subtilis 168: BSU24590
Entry
BSU24590          CDS       T00010                                 
Symbol
yqhG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YqhG PRD Thioredoxin_11
Other DBs
NCBI-GeneID: 938541
NCBI-ProteinID: NP_390339
Pasteur: BG11698
BSORF: BG11698
UniProt: P54508 A0A6M4JJD5
Position
2551469..2552263
AA seq 264 aa
MRQQEVHDFLLRFFQANSCQIVDQGLGYMTVQLTVEMDKQIMNRPFYWHWREKTGGDPNP
MKITFITDKENAPKDLDGEFIYFGAPRLFQIFKAVKQNGRFTRMYEKIESAGAKVPLQPW
LGINVTISYQSDMKKDKLLSLGLHLVSGTIIEDFQSKLTQFSLTSQICDYCFTISPMIKP
ESGLKRMENYISKSAMQEPSDWAEQAVNRWKNDMTLLDKFYEHIEEKPEEYHLEKQALKT
LYQPKISVEIENGGLFYLQNNISS
NT seq 795 nt   +upstreamnt  +downstreamnt
gtgagacagcaagaggttcacgattttctgctgcgtttttttcaagcaaacagctgccaa
atcgtcgatcaaggcttaggctatatgacagtgcagcttacagttgaaatggacaaacaa
atcatgaaccgccctttctactggcattggcgcgagaagacaggcggtgatccgaatcca
atgaaaatcacttttattacagataaagaaaatgcgccaaaagacctagatggtgaattt
atatattttggggccccgcgtctttttcaaatattcaaagctgttaaacaaaatgggaga
tttaccagaatgtatgagaaaattgaatcagccggagctaaagtcccacttcagccttgg
cttggtataaatgtcacgatttcataccagtccgacatgaaaaaggataagttattgtca
ctaggtcttcacctagtctctggaacgataattgaagattttcaaagcaagctgacccag
ttttcactgacgtctcaaatatgtgactattgcttcaccatttcacctatgatcaaacca
gaaagcggacttaagcgtatggaaaactatatttccaaatccgctatgcaggagccgtcc
gactgggcggaacaggcggttaacaggtggaagaatgatatgacattgcttgataagttt
tacgagcatatagaagaaaaaccagaagaataccatctagaaaaacaggcgctgaaaacc
ttgtatcaaccaaagatatcagttgaaattgaaaatggcggattgttttatctgcaaaat
aatatttcaagctaa

DBGET integrated database retrieval system